Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 672184..672815 | Replicon | plasmid pHAMBI540a |
Accession | NZ_HG938354 | ||
Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A068SZT5 |
Locus tag | RG540_RS25695 | Protein ID | WP_041364739.1 |
Coordinates | 672184..672570 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A068SYK7 |
Locus tag | RG540_RS25700 | Protein ID | WP_040124628.1 |
Coordinates | 672567..672815 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG540_RS25675 | 667934..668749 | - | 816 | WP_046600622.1 | ABC transporter ATP-binding protein | - |
RG540_RS25680 | 668806..669831 | - | 1026 | WP_080725073.1 | ABC transporter substrate-binding protein | - |
RG540_RS25685 | 669970..670854 | + | 885 | WP_041366359.1 | helix-turn-helix transcriptional regulator | - |
RG540_RS25690 | 670957..671610 | + | 654 | WP_041364737.1 | HAD hydrolase-like protein | - |
RG540_RS32520 | 672017..672166 | - | 150 | WP_157884686.1 | hypothetical protein | - |
RG540_RS25695 | 672184..672570 | - | 387 | WP_041364739.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
RG540_RS25700 | 672567..672815 | - | 249 | WP_040124628.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
RG540_RS25705 | 673362..674363 | + | 1002 | WP_051909790.1 | LysR family transcriptional regulator | - |
RG540_RS25710 | 674390..675850 | + | 1461 | WP_041366361.1 | NAD(P)/FAD-dependent oxidoreductase | - |
RG540_RS25715 | 675885..676802 | + | 918 | WP_041366363.1 | ABC transporter permease | - |
RG540_RS25720 | 676811..677668 | + | 858 | WP_041364741.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ddhA / htpB | 1..1807065 | 1807065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13969.03 Da Isoelectric Point: 5.1800
>T285151 WP_041364739.1 NZ_HG938354:c672570-672184 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MIVDTSALVAILYREPEAARFVKAIHEVELTRISVANYVELSMVVEGQLGLDGMRQAEAFLRRAGIIVEPVTLDHGELAR
QAFLDFGKGRHKAGLNFGDCFAYALAKATGEPLLFKGNDFSQTDVQAA
MIVDTSALVAILYREPEAARFVKAIHEVELTRISVANYVELSMVVEGQLGLDGMRQAEAFLRRAGIIVEPVTLDHGELAR
QAFLDFGKGRHKAGLNFGDCFAYALAKATGEPLLFKGNDFSQTDVQAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068SZT5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068SYK7 |