Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 253314..253999 | Replicon | plasmid pHAMBI540a |
Accession | NZ_HG938354 | ||
Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A068T0F6 |
Locus tag | RG540_RS23785 | Protein ID | WP_041364108.1 |
Coordinates | 253314..253736 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A068SYQ3 |
Locus tag | RG540_RS23790 | Protein ID | WP_041364111.1 |
Coordinates | 253733..253999 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG540_RS23765 | 248699..249619 | - | 921 | WP_041364102.1 | ABC transporter permease | - |
RG540_RS23770 | 249661..251181 | - | 1521 | WP_041364103.1 | ABC transporter substrate-binding protein | - |
RG540_RS23775 | 251393..252178 | + | 786 | WP_041364104.1 | IclR family transcriptional regulator | - |
RG540_RS23780 | 252251..252973 | + | 723 | WP_041364107.1 | ribonuclease activity regulator RraA | - |
RG540_RS23785 | 253314..253736 | - | 423 | WP_041364108.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
RG540_RS23790 | 253733..253999 | - | 267 | WP_041364111.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
RG540_RS23795 | 254088..254528 | - | 441 | WP_041364114.1 | fucose-binding protein | - |
RG540_RS23800 | 254893..255954 | + | 1062 | WP_041364117.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
RG540_RS23805 | 256031..257692 | + | 1662 | WP_041364118.1 | sugar ABC transporter substrate-binding protein | - |
RG540_RS23810 | 257803..258912 | + | 1110 | WP_041364121.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ddhA / htpB | 1..1807065 | 1807065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15427.67 Da Isoelectric Point: 4.9436
>T285150 WP_041364108.1 NZ_HG938354:c253736-253314 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
VRLLIDTNVLPEVTKPRPDARVLEWLGGLDEDRAYISVISIAEIRRGVALMDSGQKRDTLAEWLSHDLPQRFEGRVIPVE
EPVALSWGDLMALAKQSGRGLASMDGLIAATAIAHHLTLATRNTKDFEGFGIDMINPWNG
VRLLIDTNVLPEVTKPRPDARVLEWLGGLDEDRAYISVISIAEIRRGVALMDSGQKRDTLAEWLSHDLPQRFEGRVIPVE
EPVALSWGDLMALAKQSGRGLASMDGLIAATAIAHHLTLATRNTKDFEGFGIDMINPWNG
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068T0F6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068SYQ3 |