Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
Location | 172573..173207 | Replicon | plasmid pHAMBI540a |
Accession | NZ_HG938354 | ||
Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A068SYI0 |
Locus tag | RG540_RS23380 | Protein ID | WP_041363971.1 |
Coordinates | 172573..172944 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A068SX90 |
Locus tag | RG540_RS23385 | Protein ID | WP_041363973.1 |
Coordinates | 172944..173207 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG540_RS23350 | 168023..169600 | + | 1578 | WP_041363961.1 | ATP-binding cassette domain-containing protein | - |
RG540_RS23355 | 169607..170164 | - | 558 | WP_041366245.1 | isochorismatase family protein | - |
RG540_RS23360 | 170388..170621 | - | 234 | WP_041363963.1 | hypothetical protein | - |
RG540_RS23365 | 170781..171563 | - | 783 | WP_041363966.1 | SDR family oxidoreductase | - |
RG540_RS23370 | 171654..172073 | - | 420 | WP_041363967.1 | HD domain-containing protein | - |
RG540_RS23375 | 172133..172507 | - | 375 | WP_041363969.1 | GFA family protein | - |
RG540_RS23380 | 172573..172944 | - | 372 | WP_041363971.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
RG540_RS23385 | 172944..173207 | - | 264 | WP_041363973.1 | PbsX family transcriptional regulator | Antitoxin |
RG540_RS23390 | 173374..173877 | + | 504 | WP_041366246.1 | hypothetical protein | - |
RG540_RS23395 | 173901..175277 | - | 1377 | WP_041363976.1 | FAD-binding protein | - |
RG540_RS23400 | 175274..176929 | - | 1656 | WP_041363978.1 | thiamine pyrophosphate-requiring protein | - |
RG540_RS23405 | 176959..178191 | - | 1233 | WP_041363981.1 | alpha-hydroxy-acid oxidizing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ddhA / htpB | 1..1807065 | 1807065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13449.41 Da Isoelectric Point: 6.7170
>T285149 WP_041363971.1 NZ_HG938354:c172944-172573 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MIHSNVPRRGDVYWIDPNPVAGREMKNRHRFVVITPIEINRLGVSMTVPITTGGAFIRDVGLAVAISGHDTTGVAVCNQV
RSFDIPARIQQKTAQYIETLDEATMNEIVSRVVSAIDPAPEPA
MIHSNVPRRGDVYWIDPNPVAGREMKNRHRFVVITPIEINRLGVSMTVPITTGGAFIRDVGLAVAISGHDTTGVAVCNQV
RSFDIPARIQQKTAQYIETLDEATMNEIVSRVVSAIDPAPEPA
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068SYI0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068SX90 |