Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 1481116..1481635 | Replicon | chromosome |
| Accession | NZ_HG938353 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A068SPD5 |
| Locus tag | RG540_RS07575 | Protein ID | WP_038586268.1 |
| Coordinates | 1481354..1481635 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A068SN99 |
| Locus tag | RG540_RS07570 | Protein ID | WP_038586265.1 |
| Coordinates | 1481116..1481364 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS07550 | 1476581..1477345 | + | 765 | WP_038586255.1 | DUF1028 domain-containing protein | - |
| RG540_RS07555 | 1477372..1479183 | + | 1812 | WP_038593297.1 | ABC transporter ATP-binding protein | - |
| RG540_RS07560 | 1479297..1480100 | - | 804 | WP_038586259.1 | DNA repair protein RadC | - |
| RG540_RS07565 | 1480104..1480940 | - | 837 | WP_038586262.1 | type I methionyl aminopeptidase | - |
| RG540_RS07570 | 1481116..1481364 | + | 249 | WP_038586265.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| RG540_RS07575 | 1481354..1481635 | + | 282 | WP_038586268.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG540_RS07580 | 1481611..1482339 | - | 729 | WP_038586271.1 | DNA/RNA nuclease SfsA | - |
| RG540_RS07585 | 1482351..1484210 | - | 1860 | WP_038586274.1 | class I poly(R)-hydroxyalkanoic acid synthase | - |
| RG540_RS07590 | 1484334..1484735 | + | 402 | WP_038586276.1 | hypothetical protein | - |
| RG540_RS07595 | 1484898..1486115 | + | 1218 | WP_038586280.1 | LL-diaminopimelate aminotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11022.85 Da Isoelectric Point: 10.4957
>T285145 WP_038586268.1 NZ_HG938353:1481354-1481635 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MSYELAFLDVALKEWRKLDSNIREQFKKKLAERLEDPRVTAAQLHVSKDRYKIKLRSIGYRLVYEVRDTQLIVLVVAVGR
RDRDAVYKGAEKR
MSYELAFLDVALKEWRKLDSNIREQFKKKLAERLEDPRVTAAQLHVSKDRYKIKLRSIGYRLVYEVRDTQLIVLVVAVGR
RDRDAVYKGAEKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SPD5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SN99 |