Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-PrlF
Location 1286628..1287186 Replicon chromosome
Accession NZ_HG938353
Organism Neorhizobium galegae bv. orientalis str. HAMBI 540

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag RG540_RS06600 Protein ID WP_038585882.1
Coordinates 1286830..1287186 (+) Length 119 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A068SP21
Locus tag RG540_RS06595 Protein ID WP_038585878.1
Coordinates 1286628..1286843 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG540_RS06575 1282045..1282710 - 666 WP_038585866.1 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ -
RG540_RS06580 1282711..1283655 - 945 WP_038585869.1 protein-methionine-sulfoxide reductase catalytic subunit MsrP -
RG540_RS06585 1283865..1284275 + 411 WP_038585872.1 DUF4112 domain-containing protein -
RG540_RS31075 1284277..1284489 - 213 WP_051909596.1 DUF1902 domain-containing protein -
RG540_RS06590 1284684..1286519 + 1836 WP_038585875.1 dihydroxy-acid dehydratase -
RG540_RS06595 1286628..1286843 + 216 WP_038585878.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
RG540_RS06600 1286830..1287186 + 357 WP_038585882.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
RG540_RS06605 1287193..1287552 - 360 WP_038585885.1 periplasmic protein -
RG540_RS06610 1287590..1287952 - 363 WP_038593174.1 DUF1232 domain-containing protein -
RG540_RS06615 1288107..1289507 + 1401 WP_038585888.1 DegQ family serine endoprotease -
RG540_RS06620 1289504..1290820 + 1317 WP_038585894.1 replication-associated recombination protein A -
RG540_RS06625 1290839..1291153 - 315 WP_038585897.1 DUF1883 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-107)

Antitoxin

PrlF antitoxin

(4-53)


Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 12902.78 Da        Isoelectric Point: 5.7235

>T285144 WP_038585882.1 NZ_HG938353:1286830-1287186 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MPTFEQGDIVRVPFPYTDRDTRQRRPALVVSSGDLGEEAALLWVVMITSAENRPWTDDIAISDHGSAGLPAPSVVRPVKI
ATVEARHVEPIGKLPDEIRQSVIRRIAGILSIAPRADV

Download         Length: 357 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8031.90 Da        Isoelectric Point: 4.3417

>AT285144 WP_038585878.1 NZ_HG938353:1286628-1286843 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MITSRLSSKSQTTIPQPVRNALKLREGDELVYTFEPDGRVLISRASQPVDDPFATFDEWDSDADRKAYADL

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A068SP21

References