Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-PrlF |
| Location | 1286628..1287186 | Replicon | chromosome |
| Accession | NZ_HG938353 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | RG540_RS06600 | Protein ID | WP_038585882.1 |
| Coordinates | 1286830..1287186 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A068SP21 |
| Locus tag | RG540_RS06595 | Protein ID | WP_038585878.1 |
| Coordinates | 1286628..1286843 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS06575 | 1282045..1282710 | - | 666 | WP_038585866.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
| RG540_RS06580 | 1282711..1283655 | - | 945 | WP_038585869.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
| RG540_RS06585 | 1283865..1284275 | + | 411 | WP_038585872.1 | DUF4112 domain-containing protein | - |
| RG540_RS31075 | 1284277..1284489 | - | 213 | WP_051909596.1 | DUF1902 domain-containing protein | - |
| RG540_RS06590 | 1284684..1286519 | + | 1836 | WP_038585875.1 | dihydroxy-acid dehydratase | - |
| RG540_RS06595 | 1286628..1286843 | + | 216 | WP_038585878.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| RG540_RS06600 | 1286830..1287186 | + | 357 | WP_038585882.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| RG540_RS06605 | 1287193..1287552 | - | 360 | WP_038585885.1 | periplasmic protein | - |
| RG540_RS06610 | 1287590..1287952 | - | 363 | WP_038593174.1 | DUF1232 domain-containing protein | - |
| RG540_RS06615 | 1288107..1289507 | + | 1401 | WP_038585888.1 | DegQ family serine endoprotease | - |
| RG540_RS06620 | 1289504..1290820 | + | 1317 | WP_038585894.1 | replication-associated recombination protein A | - |
| RG540_RS06625 | 1290839..1291153 | - | 315 | WP_038585897.1 | DUF1883 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12902.78 Da Isoelectric Point: 5.7235
>T285144 WP_038585882.1 NZ_HG938353:1286830-1287186 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MPTFEQGDIVRVPFPYTDRDTRQRRPALVVSSGDLGEEAALLWVVMITSAENRPWTDDIAISDHGSAGLPAPSVVRPVKI
ATVEARHVEPIGKLPDEIRQSVIRRIAGILSIAPRADV
MPTFEQGDIVRVPFPYTDRDTRQRRPALVVSSGDLGEEAALLWVVMITSAENRPWTDDIAISDHGSAGLPAPSVVRPVKI
ATVEARHVEPIGKLPDEIRQSVIRRIAGILSIAPRADV
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|