Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 891945..892540 Replicon chromosome
Accession NZ_HG938353
Organism Neorhizobium galegae bv. orientalis str. HAMBI 540

Toxin (Protein)


Gene name vapC Uniprot ID A0A068SLI1
Locus tag RG540_RS04535 Protein ID WP_038585076.1
Coordinates 891945..892310 (-) Length 122 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A068SLL3
Locus tag RG540_RS04540 Protein ID WP_038541378.1
Coordinates 892307..892540 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG540_RS04510 886992..888218 - 1227 WP_051909239.1 efflux RND transporter periplasmic adaptor subunit -
RG540_RS04515 888420..888623 - 204 WP_038585069.1 hypothetical protein -
RG540_RS04520 888724..889092 - 369 WP_038541369.1 hypothetical protein -
RG540_RS04525 889215..890003 - 789 WP_038585071.1 SDR family oxidoreductase -
RG540_RS04530 890262..891938 + 1677 WP_038585073.1 electron transfer flavoprotein-ubiquinone oxidoreductase -
RG540_RS04535 891945..892310 - 366 WP_038585076.1 PIN domain-containing protein Toxin
RG540_RS04540 892307..892540 - 234 WP_038541378.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
RG540_RS04545 892733..893344 + 612 WP_038585079.1 L,D-transpeptidase -
RG540_RS04550 893420..894436 - 1017 WP_038585082.1 zinc-binding alcohol dehydrogenase family protein -
RG540_RS04555 894560..894955 + 396 WP_038585085.1 helix-turn-helix transcriptional regulator -
RG540_RS04560 894956..896197 - 1242 WP_038585087.1 MFS transporter -
RG540_RS04565 896470..897408 + 939 WP_038585090.1 diacylglycerol kinase family lipid kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 122 a.a.        Molecular weight: 13511.90 Da        Isoelectric Point: 7.4681

>T285143 WP_038585076.1 NZ_HG938353:c892310-891945 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
VILLDTSIWIDHLRKREEAVEFLLKRKQILVHPFVIGEVALGPMPRYDLVLQSLSELPQALVASDPEVLLLIRQHSLMGS
GVGYVDAHLLASTKLHEGTRLLTRDKRLARIATALGIGYEP

Download         Length: 366 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8643.83 Da        Isoelectric Point: 6.3355

>AT285143 WP_038541378.1 NZ_HG938353:c892540-892307 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MRTTVTIDDKLLARAQEVTGIKERSLLLKEALTRLIQEEAARRLIALGGSAPDLEAPPRRRWNLDGTWGGSDWDKSE

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068SLI1

Antitoxin

Source ID Structure
AlphaFold DB A0A068SLL3

References