Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 891945..892540 | Replicon | chromosome |
| Accession | NZ_HG938353 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A068SLI1 |
| Locus tag | RG540_RS04535 | Protein ID | WP_038585076.1 |
| Coordinates | 891945..892310 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A068SLL3 |
| Locus tag | RG540_RS04540 | Protein ID | WP_038541378.1 |
| Coordinates | 892307..892540 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS04510 | 886992..888218 | - | 1227 | WP_051909239.1 | efflux RND transporter periplasmic adaptor subunit | - |
| RG540_RS04515 | 888420..888623 | - | 204 | WP_038585069.1 | hypothetical protein | - |
| RG540_RS04520 | 888724..889092 | - | 369 | WP_038541369.1 | hypothetical protein | - |
| RG540_RS04525 | 889215..890003 | - | 789 | WP_038585071.1 | SDR family oxidoreductase | - |
| RG540_RS04530 | 890262..891938 | + | 1677 | WP_038585073.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
| RG540_RS04535 | 891945..892310 | - | 366 | WP_038585076.1 | PIN domain-containing protein | Toxin |
| RG540_RS04540 | 892307..892540 | - | 234 | WP_038541378.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| RG540_RS04545 | 892733..893344 | + | 612 | WP_038585079.1 | L,D-transpeptidase | - |
| RG540_RS04550 | 893420..894436 | - | 1017 | WP_038585082.1 | zinc-binding alcohol dehydrogenase family protein | - |
| RG540_RS04555 | 894560..894955 | + | 396 | WP_038585085.1 | helix-turn-helix transcriptional regulator | - |
| RG540_RS04560 | 894956..896197 | - | 1242 | WP_038585087.1 | MFS transporter | - |
| RG540_RS04565 | 896470..897408 | + | 939 | WP_038585090.1 | diacylglycerol kinase family lipid kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13511.90 Da Isoelectric Point: 7.4681
>T285143 WP_038585076.1 NZ_HG938353:c892310-891945 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
VILLDTSIWIDHLRKREEAVEFLLKRKQILVHPFVIGEVALGPMPRYDLVLQSLSELPQALVASDPEVLLLIRQHSLMGS
GVGYVDAHLLASTKLHEGTRLLTRDKRLARIATALGIGYEP
VILLDTSIWIDHLRKREEAVEFLLKRKQILVHPFVIGEVALGPMPRYDLVLQSLSELPQALVASDPEVLLLIRQHSLMGS
GVGYVDAHLLASTKLHEGTRLLTRDKRLARIATALGIGYEP
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SLI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SLL3 |