Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 770034..770590 Replicon chromosome
Accession NZ_HG938353
Organism Neorhizobium galegae bv. orientalis str. HAMBI 540

Toxin (Protein)


Gene name mazF Uniprot ID A0A068SMI0
Locus tag RG540_RS03890 Protein ID WP_038584788.1
Coordinates 770249..770590 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A6A1TLV1
Locus tag RG540_RS03885 Protein ID WP_038584785.1
Coordinates 770034..770252 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG540_RS03845 765751..766005 + 255 WP_038584771.1 type II toxin-antitoxin system HicA family toxin -
RG540_RS03850 766002..766331 + 330 WP_038584774.1 type II toxin-antitoxin system HicB family antitoxin -
RG540_RS03855 766348..766845 - 498 WP_038584777.1 GNAT family N-acetyltransferase -
RG540_RS03860 767023..767997 - 975 WP_038592995.1 prolyl aminopeptidase -
RG540_RS03865 768130..768423 + 294 WP_038584779.1 hypothetical protein -
RG540_RS03870 768410..768772 + 363 WP_038584782.1 hypothetical protein -
RG540_RS03875 768792..769205 - 414 WP_038541031.1 helix-turn-helix domain-containing protein -
RG540_RS31045 769359..769910 - 552 WP_051909231.1 hypothetical protein -
RG540_RS03885 770034..770252 + 219 WP_038584785.1 antitoxin MazE family protein Antitoxin
RG540_RS03890 770249..770590 + 342 WP_038584788.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
RG540_RS03895 770686..770958 + 273 WP_038584791.1 Ni(II)/Co(II)-sensing transcriptional repressor DmeR -
RG540_RS03900 770979..771953 + 975 WP_038584794.1 CDF family Co(II)/Ni(II) efflux transporter DmeF -
RG540_RS03905 771963..772238 - 276 WP_038584797.1 hypothetical protein -
RG540_RS03910 772533..773048 - 516 WP_038584800.1 DUF1697 domain-containing protein -
RG540_RS03915 773282..775390 - 2109 WP_038584803.1 S9 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-100)

Antitoxin

Antitoxin MazE-like

(9-71)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12520.28 Da        Isoelectric Point: 8.5264

>T285142 WP_038584788.1 NZ_HG938353:770249-770590 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
VKRGEVWTVSGGNDYAGKPRPCVVVQDDSFGGTDSVTICIFTTYEVDAPLFRLHVRPDERNGLHQASWLTVDKIATVPRS
KIGERLGRLRDDDILRLNRSALVFLGLASPRLA

Download         Length: 342 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8037.97 Da        Isoelectric Point: 8.6826

>AT285142 WP_038584785.1 NZ_HG938353:770034-770252 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MPAKPKSSREKVRQHRERLRDQGLRPVQIWVPDVRSAAFKAEAYRQSLATAASAGAAEDQAFVDSIADWADE

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068SMI0

Antitoxin

Source ID Structure
AlphaFold DB A0A6A1TLV1

References