Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 770034..770590 | Replicon | chromosome |
| Accession | NZ_HG938353 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A068SMI0 |
| Locus tag | RG540_RS03890 | Protein ID | WP_038584788.1 |
| Coordinates | 770249..770590 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A6A1TLV1 |
| Locus tag | RG540_RS03885 | Protein ID | WP_038584785.1 |
| Coordinates | 770034..770252 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS03845 | 765751..766005 | + | 255 | WP_038584771.1 | type II toxin-antitoxin system HicA family toxin | - |
| RG540_RS03850 | 766002..766331 | + | 330 | WP_038584774.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| RG540_RS03855 | 766348..766845 | - | 498 | WP_038584777.1 | GNAT family N-acetyltransferase | - |
| RG540_RS03860 | 767023..767997 | - | 975 | WP_038592995.1 | prolyl aminopeptidase | - |
| RG540_RS03865 | 768130..768423 | + | 294 | WP_038584779.1 | hypothetical protein | - |
| RG540_RS03870 | 768410..768772 | + | 363 | WP_038584782.1 | hypothetical protein | - |
| RG540_RS03875 | 768792..769205 | - | 414 | WP_038541031.1 | helix-turn-helix domain-containing protein | - |
| RG540_RS31045 | 769359..769910 | - | 552 | WP_051909231.1 | hypothetical protein | - |
| RG540_RS03885 | 770034..770252 | + | 219 | WP_038584785.1 | antitoxin MazE family protein | Antitoxin |
| RG540_RS03890 | 770249..770590 | + | 342 | WP_038584788.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| RG540_RS03895 | 770686..770958 | + | 273 | WP_038584791.1 | Ni(II)/Co(II)-sensing transcriptional repressor DmeR | - |
| RG540_RS03900 | 770979..771953 | + | 975 | WP_038584794.1 | CDF family Co(II)/Ni(II) efflux transporter DmeF | - |
| RG540_RS03905 | 771963..772238 | - | 276 | WP_038584797.1 | hypothetical protein | - |
| RG540_RS03910 | 772533..773048 | - | 516 | WP_038584800.1 | DUF1697 domain-containing protein | - |
| RG540_RS03915 | 773282..775390 | - | 2109 | WP_038584803.1 | S9 family peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12520.28 Da Isoelectric Point: 8.5264
>T285142 WP_038584788.1 NZ_HG938353:770249-770590 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
VKRGEVWTVSGGNDYAGKPRPCVVVQDDSFGGTDSVTICIFTTYEVDAPLFRLHVRPDERNGLHQASWLTVDKIATVPRS
KIGERLGRLRDDDILRLNRSALVFLGLASPRLA
VKRGEVWTVSGGNDYAGKPRPCVVVQDDSFGGTDSVTICIFTTYEVDAPLFRLHVRPDERNGLHQASWLTVDKIATVPRS
KIGERLGRLRDDDILRLNRSALVFLGLASPRLA
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SMI0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A1TLV1 |