285141

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 765751..766331 Replicon chromosome
Accession NZ_HG938353
Organism Neorhizobium galegae bv. orientalis str. HAMBI 540

Toxin (Protein)


Gene name hicA Uniprot ID A0A068SL96
Locus tag RG540_RS03845 Protein ID WP_038584771.1
Coordinates 765751..766005 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A068SMA4
Locus tag RG540_RS03850 Protein ID WP_038584774.1
Coordinates 766002..766331 (+) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG540_RS03815 761048..761890 + 843 WP_038584753.1 metallophosphoesterase -
RG540_RS03820 761893..762537 - 645 WP_038584756.1 ThuA domain-containing protein -
RG540_RS03825 762634..763323 - 690 WP_038584759.1 YafY family transcriptional regulator -
RG540_RS03830 763459..764091 + 633 WP_038584762.1 LysE family translocator -
RG540_RS03835 764271..764711 + 441 WP_038584765.1 cytochrome c -
RG540_RS03840 764792..765706 + 915 WP_038584768.1 cytochrome c -
RG540_RS03845 765751..766005 + 255 WP_038584771.1 type II toxin-antitoxin system HicA family toxin Toxin
RG540_RS03850 766002..766331 + 330 WP_038584774.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
RG540_RS03855 766348..766845 - 498 WP_038584777.1 GNAT family N-acetyltransferase -
RG540_RS03860 767023..767997 - 975 WP_038592995.1 prolyl aminopeptidase -
RG540_RS03865 768130..768423 + 294 WP_038584779.1 hypothetical protein -
RG540_RS03870 768410..768772 + 363 WP_038584782.1 hypothetical protein -
RG540_RS03875 768792..769205 - 414 WP_038541031.1 helix-turn-helix domain-containing protein -
RG540_RS31045 769359..769910 - 552 WP_051909231.1 hypothetical protein -
RG540_RS03885 770034..770252 + 219 WP_038584785.1 antitoxin MazE family protein -
RG540_RS03890 770249..770590 + 342 WP_038584788.1 type II toxin-antitoxin system PemK/MazF family toxin -
RG540_RS03895 770686..770958 + 273 WP_038584791.1 Ni(II)/Co(II)-sensing transcriptional repressor DmeR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-82)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9594.04 Da        Isoelectric Point: 9.8829

>T285141 WP_038584771.1 NZ_HG938353:765751-766005 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MNSKQRKTLGAIFRDPVSPSIDWSDVENLLIAIGCRLLEGNGSRVRFEKDGLVAFFHRPHPDKEAKRYQIKDARLFLSQL
GIEP

Download         Length: 255 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 11877.32 Da        Isoelectric Point: 4.9230

>AT285141 WP_038584774.1 NZ_HG938353:766002-766331 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MNVLEYKGYSARIEFDAEDEIFVGHIAGIADVVGFHADSVADLKTAFHEAVDDYLETCERLGRSPHKPYSGRVMFRIDPD
VHARAAKAAELAGKSLNEWAGEVLAKAAG

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068SL96

Antitoxin

Source ID Structure
AlphaFold DB A0A068SMA4

References