Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 340709..341192 | Replicon | chromosome |
| Accession | NZ_HG938353 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | A0A6A1TMY6 |
| Locus tag | RG540_RS01650 | Protein ID | WP_038583955.1 |
| Coordinates | 340709..340978 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A068SL44 |
| Locus tag | RG540_RS01655 | Protein ID | WP_038583958.1 |
| Coordinates | 340962..341192 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS01615 | 335845..336537 | - | 693 | WP_038583942.1 | L,D-transpeptidase | - |
| RG540_RS01620 | 336686..337462 | - | 777 | WP_080725008.1 | L,D-transpeptidase | - |
| RG540_RS01625 | 337704..338333 | + | 630 | WP_038583945.1 | DNA-3-methyladenine glycosylase I | - |
| RG540_RS01630 | 338320..339024 | - | 705 | WP_038592837.1 | HAD family hydrolase | - |
| RG540_RS01635 | 339112..339483 | - | 372 | WP_038583947.1 | DUF305 domain-containing protein | - |
| RG540_RS01640 | 339541..339906 | - | 366 | WP_038583950.1 | hypothetical protein | - |
| RG540_RS01645 | 339953..340705 | - | 753 | WP_038583953.1 | hypothetical protein | - |
| RG540_RS01650 | 340709..340978 | - | 270 | WP_038583955.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG540_RS01655 | 340962..341192 | - | 231 | WP_038583958.1 | hypothetical protein | Antitoxin |
| RG540_RS01660 | 341337..342908 | + | 1572 | WP_038583961.1 | histidine--tRNA ligase | - |
| RG540_RS01665 | 343107..344228 | + | 1122 | WP_038583964.1 | ATP phosphoribosyltransferase regulatory subunit | - |
| RG540_RS01670 | 344225..344923 | + | 699 | WP_038583967.1 | ATP phosphoribosyltransferase | - |
| RG540_RS01675 | 344946..345350 | + | 405 | WP_037085509.1 | GFA family protein | - |
| RG540_RS01680 | 345416..345865 | - | 450 | WP_038583970.1 | DoxX family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10402.99 Da Isoelectric Point: 9.5680
>T285138 WP_038583955.1 NZ_HG938353:c340978-340709 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MAWTIELRASAEKQLGRLAKRDAARIISFLEERLATHENPRELGDALKGHALGGYWRYRVGDYRIICDIQDQRLVVLVIE
IGHRREVYR
MAWTIELRASAEKQLGRLAKRDAARIISFLEERLATHENPRELGDALKGHALGGYWRYRVGDYRIICDIQDQRLVVLVIE
IGHRREVYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A1TMY6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SL44 |