285138

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 340709..341192 Replicon chromosome
Accession NZ_HG938353
Organism Neorhizobium galegae bv. orientalis str. HAMBI 540

Toxin (Protein)


Gene name pasB Uniprot ID A0A6A1TMY6
Locus tag RG540_RS01650 Protein ID WP_038583955.1
Coordinates 340709..340978 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A068SL44
Locus tag RG540_RS01655 Protein ID WP_038583958.1
Coordinates 340962..341192 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG540_RS01615 335845..336537 - 693 WP_038583942.1 L,D-transpeptidase -
RG540_RS01620 336686..337462 - 777 WP_080725008.1 L,D-transpeptidase -
RG540_RS01625 337704..338333 + 630 WP_038583945.1 DNA-3-methyladenine glycosylase I -
RG540_RS01630 338320..339024 - 705 WP_038592837.1 HAD family hydrolase -
RG540_RS01635 339112..339483 - 372 WP_038583947.1 DUF305 domain-containing protein -
RG540_RS01640 339541..339906 - 366 WP_038583950.1 hypothetical protein -
RG540_RS01645 339953..340705 - 753 WP_038583953.1 hypothetical protein -
RG540_RS01650 340709..340978 - 270 WP_038583955.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
RG540_RS01655 340962..341192 - 231 WP_038583958.1 hypothetical protein Antitoxin
RG540_RS01660 341337..342908 + 1572 WP_038583961.1 histidine--tRNA ligase -
RG540_RS01665 343107..344228 + 1122 WP_038583964.1 ATP phosphoribosyltransferase regulatory subunit -
RG540_RS01670 344225..344923 + 699 WP_038583967.1 ATP phosphoribosyltransferase -
RG540_RS01675 344946..345350 + 405 WP_037085509.1 GFA family protein -
RG540_RS01680 345416..345865 - 450 WP_038583970.1 DoxX family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(13-88)

Antitoxin

Protein of unknown function DUF6290

(5-69)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10402.99 Da        Isoelectric Point: 9.5680

>T285138 WP_038583955.1 NZ_HG938353:c340978-340709 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MAWTIELRASAEKQLGRLAKRDAARIISFLEERLATHENPRELGDALKGHALGGYWRYRVGDYRIICDIQDQRLVVLVIE
IGHRREVYR

Download         Length: 270 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8615.72 Da        Isoelectric Point: 4.2782

>AT285138 WP_038583958.1 NZ_HG938353:c341192-340962 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MNKRVTIEMPEEMHEAITEHAAKAGAKTDAYVLDLIEQHLEDLHDIALAEAAMERIRDGEPTYTLEEVKLRLGLDD

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6A1TMY6

Antitoxin

Source ID Structure
AlphaFold DB A0A068SL44

References