Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 5367103..5367742 | Replicon | chromosome |
Accession | NZ_HG917972 | ||
Organism | Mycobacterium marinum E11 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | A0A2Z5YL42 |
Locus tag | MMARE11_RS22015 | Protein ID | WP_020729617.1 |
Coordinates | 5367103..5367549 (-) | Length | 149 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | B2HEJ8 |
Locus tag | MMARE11_RS22020 | Protein ID | WP_011738542.1 |
Coordinates | 5367554..5367742 (-) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MMARE11_RS21990 | 5362278..5363798 | + | 1521 | WP_020729620.1 | carotenoid oxygenase family protein | - |
MMARE11_RS21995 | 5363815..5364288 | + | 474 | WP_012396158.1 | VOC family protein | - |
MMARE11_RS22000 | 5364294..5364728 | - | 435 | WP_038580760.1 | hypothetical protein | - |
MMARE11_RS22005 | 5364799..5365572 | - | 774 | WP_020729619.1 | VOC family protein | - |
MMARE11_RS22010 | 5365741..5366991 | + | 1251 | WP_036456440.1 | hypothetical protein | - |
MMARE11_RS22015 | 5367103..5367549 | - | 447 | WP_020729617.1 | SRPBCC family protein | Toxin |
MMARE11_RS22020 | 5367554..5367742 | - | 189 | WP_011738542.1 | antitoxin | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15851.39 Da Isoelectric Point: 8.6574
>T285136 WP_020729617.1 NZ_HG917972:c5367549-5367103 [Mycobacterium marinum E11]
MAKLSGSIDVPLSPDEAWMHASDLSRFKEWLTIHRVWRSTLPETLEKGAVVESIVQVKGMHNRIKWTIVRYQPPEGMTLN
GDGVGGVKVKLMAKVAAGEEGSVVSFDVHLGGPALFGPIGMVVAAALRTDINASLRNFVTVFAPSAAG
MAKLSGSIDVPLSPDEAWMHASDLSRFKEWLTIHRVWRSTLPETLEKGAVVESIVQVKGMHNRIKWTIVRYQPPEGMTLN
GDGVGGVKVKLMAKVAAGEEGSVVSFDVHLGGPALFGPIGMVVAAALRTDINASLRNFVTVFAPSAAG
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Z5YL42 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7I7LB02 |