Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 3435654..3436189 Replicon chromosome
Accession NZ_HG917972
Organism Mycobacterium marinum E11

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z5YH00
Locus tag MMARE11_RS14210 Protein ID WP_036455701.1
Coordinates 3435857..3436189 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A7I7LGS6
Locus tag MMARE11_RS14205 Protein ID WP_036455700.1
Coordinates 3435654..3435860 (+) Length 69 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MMARE11_RS14185 3430972..3431790 + 819 WP_020729182.1 ParA family protein -
MMARE11_RS14190 3431883..3432710 - 828 WP_020729183.1 DUF1906 domain-containing protein -
MMARE11_RS14195 3433038..3434723 - 1686 WP_020729184.1 GMC family oxidoreductase N-terminal domain-containing protein -
MMARE11_RS14200 3434971..3435321 - 351 WP_020729185.1 cupin domain-containing protein -
MMARE11_RS14205 3435654..3435860 + 207 WP_036455700.1 DUF3018 family protein Antitoxin
MMARE11_RS14210 3435857..3436189 + 333 WP_036455701.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
MMARE11_RS14215 3436796..3437137 + 342 WP_038581564.1 DUF2384 domain-containing protein -
MMARE11_RS14220 3437138..3437692 + 555 WP_020729188.1 RES domain-containing protein -
MMARE11_RS14225 3437971..3438204 + 234 WP_020729189.1 hypothetical protein -
MMARE11_RS14230 3438194..3438505 + 312 WP_020729190.1 type II toxin-antitoxin system PemK/MazF family toxin -
MMARE11_RS14235 3439282..3440310 - 1029 WP_038579780.1 alcohol dehydrogenase catalytic domain-containing protein -
MMARE11_RS14240 3440444..3441046 + 603 WP_038579783.1 TetR/AcrR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-105)

Antitoxin

Antitoxin MazE-like

(4-66)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11841.67 Da        Isoelectric Point: 7.3196

>T285135 WP_036455701.1 NZ_HG917972:3435857-3436189 [Mycobacterium marinum E11]
VNRGEIWTVAGGVYATKPHPAVIVQDDLFDATSSVTVAPMSSTLLDAPLMRIRIAGGDGRLSGLDHNSDVMIDKLTTVKR
SNVHARVGRLTAEQVVEVERVMMAFLGLAR

Download         Length: 333 bp

Antitoxin


Download         Length: 69 a.a.        Molecular weight: 7999.86 Da        Isoelectric Point: 4.8359

>AT285135 WP_036455700.1 NZ_HG917972:3435654-3435860 [Mycobacterium marinum E11]
MAVRDRVGEYRRRMRERGLRPLQVWVPDVRTESFAAEAHRQASLVARADERGDDQDFIEAISTPWDEE

Download         Length: 207 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z5YH00

Antitoxin

Source ID Structure
AlphaFold DB A0A7I7LGS6

References