Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yoeB-relB/YoeB-YefM |
Location | 4516825..4517327 | Replicon | chromosome |
Accession | NZ_HG916826 | ||
Organism | Pseudomonas pseudoalcaligenes CECT 5344 strain CECT5344 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | W6RLX6 |
Locus tag | BN5_RS21290 | Protein ID | WP_003464804.1 |
Coordinates | 4516825..4517079 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | W6R1F7 |
Locus tag | BN5_RS21295 | Protein ID | WP_003464807.1 |
Coordinates | 4517076..4517327 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN5_RS23000 | 4511890..4512000 | - | 111 | Protein_4237 | TraR/DksA C4-type zinc finger protein | - |
BN5_RS21270 | 4512277..4512579 | - | 303 | Protein_4238 | RNA polymerase-binding protein DksA | - |
BN5_RS21275 | 4512651..4513541 | + | 891 | WP_003464796.1 | GTP cyclohydrolase I FolE2 | - |
BN5_RS21280 | 4513778..4515697 | + | 1920 | WP_003464798.1 | cyclic nucleotide-binding/CBS domain-containing protein | - |
BN5_RS21285 | 4515694..4516401 | + | 708 | WP_003464800.1 | 3'-5' exonuclease | - |
BN5_RS22245 | 4516463..4516624 | + | 162 | WP_003464802.1 | DUF2986 domain-containing protein | - |
BN5_RS21290 | 4516825..4517079 | - | 255 | WP_003464804.1 | Txe/YoeB family addiction module toxin | Toxin |
BN5_RS21295 | 4517076..4517327 | - | 252 | WP_003464807.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
BN5_RS21300 | 4517482..4518384 | - | 903 | WP_003464809.1 | LysR family transcriptional regulator | - |
BN5_RS21305 | 4518568..4519956 | + | 1389 | WP_003464812.1 | L-serine ammonia-lyase | - |
BN5_RS21310 | 4520214..4521881 | - | 1668 | WP_003464814.1 | BCCT family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4417566..4590578 | 173012 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10268.83 Da Isoelectric Point: 9.8757
>T285134 WP_003464804.1 NZ_HG916826:c4517079-4516825 [Pseudomonas pseudoalcaligenes CECT 5344]
VNLVFSEQAWADYLYWQGQDKKTLKRINELLKEIKRTPFEGMGKPEPLKHALAGYWSRRINEEHRLVYRLREHEILIAQV
RYHY
VNLVFSEQAWADYLYWQGQDKKTLKRINELLKEIKRTPFEGMGKPEPLKHALAGYWSRRINEEHRLVYRLREHEILIAQV
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|