Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 3556515..3556984 | Replicon | chromosome |
| Accession | NZ_HG916826 | ||
| Organism | Pseudomonas pseudoalcaligenes CECT 5344 strain CECT5344 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | BN5_RS22855 | Protein ID | WP_003459396.1 |
| Coordinates | 3556515..3556790 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | W6R134 |
| Locus tag | BN5_RS16685 | Protein ID | WP_003459395.1 |
| Coordinates | 3556790..3556984 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN5_RS16670 | 3554969..3555385 | + | 417 | WP_003459398.1 | type IV pilin protein | - |
| BN5_RS16675 | 3555519..3556463 | - | 945 | WP_003459397.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| BN5_RS22855 | 3556515..3556790 | - | 276 | WP_003459396.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| BN5_RS16685 | 3556790..3556984 | - | 195 | WP_003459395.1 | hypothetical protein | Antitoxin |
| BN5_RS16690 | 3557014..3557460 | - | 447 | WP_003459394.1 | peptidylprolyl isomerase | - |
| BN5_RS16695 | 3557457..3557966 | - | 510 | WP_003459393.1 | signal peptidase II | - |
| BN5_RS16700 | 3557959..3560790 | - | 2832 | WP_003459392.1 | isoleucine--tRNA ligase | - |
| BN5_RS16705 | 3560787..3561755 | - | 969 | WP_003459391.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | pilS / pilR / algW | 3520707..3706356 | 185649 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10419.02 Da Isoelectric Point: 6.7154
>T285133 WP_003459396.1 NZ_HG916826:c3556790-3556515 [Pseudomonas pseudoalcaligenes CECT 5344]
MLPIIWRDSARADLAEIIRYIADEALQAARQLKNYLESAVLPLAEHPYLYRSGRVPGTRELVAHPNYVLVYRVAAECIEV
VSVLHSRQEYP
MLPIIWRDSARADLAEIIRYIADEALQAARQLKNYLESAVLPLAEHPYLYRSGRVPGTRELVAHPNYVLVYRVAAECIEV
VSVLHSRQEYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|