Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 2437274..2437827 | Replicon | chromosome |
Accession | NZ_HG916826 | ||
Organism | Pseudomonas pseudoalcaligenes CECT 5344 strain CECT5344 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A385B7Q1 |
Locus tag | BN5_RS11315 | Protein ID | WP_003461247.1 |
Coordinates | 2437274..2437567 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | W6RG82 |
Locus tag | BN5_RS11320 | Protein ID | WP_003461245.1 |
Coordinates | 2437555..2437827 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN5_RS11290 | 2432855..2434201 | - | 1347 | WP_003461262.1 | glutamine synthetase family protein | - |
BN5_RS11295 | 2434231..2434788 | - | 558 | WP_021489866.1 | helix-turn-helix domain-containing protein | - |
BN5_RS11300 | 2434805..2436094 | - | 1290 | WP_003461258.1 | FAD-binding oxidoreductase | - |
BN5_RS11305 | 2436273..2436677 | - | 405 | Protein_2248 | DUF262 domain-containing protein | - |
BN5_RS11310 | 2436606..2437280 | + | 675 | Protein_2249 | site-specific integrase | - |
BN5_RS11315 | 2437274..2437567 | - | 294 | WP_003461247.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN5_RS11320 | 2437555..2437827 | - | 273 | WP_003461245.1 | CopG family ribbon-helix-helix protein | Antitoxin |
BN5_RS11325 | 2438016..2439515 | + | 1500 | WP_003461243.1 | IS21-like element ISPst3 family transposase | - |
BN5_RS23285 | 2439508..2440313 | + | 806 | Protein_2253 | IS21-like element helper ATPase IstB | - |
BN5_RS11335 | 2440508..2441254 | + | 747 | Protein_2254 | AIPR family protein | - |
BN5_RS23635 | 2441273..2442115 | - | 843 | WP_003461234.1 | hypothetical protein | - |
BN5_RS23290 | 2442125..2442760 | - | 636 | WP_052678213.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11183.67 Da Isoelectric Point: 5.9081
>T285131 WP_003461247.1 NZ_HG916826:c2437567-2437274 [Pseudomonas pseudoalcaligenes CECT 5344]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRVAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRVAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A385B7Q1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W6RG82 |