Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 836090..836766 | Replicon | chromosome |
Accession | NZ_HG916826 | ||
Organism | Pseudomonas pseudoalcaligenes CECT 5344 strain CECT5344 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | W6QYZ7 |
Locus tag | BN5_RS03745 | Protein ID | WP_004424726.1 |
Coordinates | 836341..836766 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | W6QR28 |
Locus tag | BN5_RS03740 | Protein ID | WP_004424728.1 |
Coordinates | 836090..836341 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN5_RS03725 | 832596..835253 | + | 2658 | WP_039965052.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
BN5_RS03730 | 835256..835537 | - | 282 | WP_004424733.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
BN5_RS03735 | 835534..835824 | - | 291 | WP_004424730.1 | hypothetical protein | - |
BN5_RS03740 | 836090..836341 | + | 252 | WP_004424728.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
BN5_RS03745 | 836341..836766 | + | 426 | WP_004424726.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BN5_RS03750 | 836876..838411 | + | 1536 | WP_004424723.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
BN5_RS03755 | 838408..838950 | + | 543 | WP_004424722.1 | type I-E CRISPR-associated protein Cse2/CasB | - |
BN5_RS03760 | 838961..840103 | + | 1143 | WP_004424719.1 | type I-E CRISPR-associated protein Cas7/Cse4/CasC | - |
BN5_RS03765 | 840106..840768 | + | 663 | WP_004424717.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
BN5_RS03770 | 840743..841357 | + | 615 | WP_004424714.1 | type I-E CRISPR-associated protein Cas6/Cse3/CasE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15393.95 Da Isoelectric Point: 8.0845
>T285128 WP_004424726.1 NZ_HG916826:836341-836766 [Pseudomonas pseudoalcaligenes CECT 5344]
MFVLDTNVVSELRKAKSAKADPRLVAWAQRLLPGQLFISAITVLELETGVLLVERRDPQQGRLLRSWLDSHVLPGFAGRI
LPVDAAVAQRCAQLHVPDPRAERDALIVATALVHGMTVATRNVADFLPTGVALINPWEFAG
MFVLDTNVVSELRKAKSAKADPRLVAWAQRLLPGQLFISAITVLELETGVLLVERRDPQQGRLLRSWLDSHVLPGFAGRI
LPVDAAVAQRCAQLHVPDPRAERDALIVATALVHGMTVATRNVADFLPTGVALINPWEFAG
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|