Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 688401..688942 | Replicon | chromosome |
Accession | NZ_HG916826 | ||
Organism | Pseudomonas pseudoalcaligenes CECT 5344 strain CECT5344 |
Toxin (Protein)
Gene name | relE | Uniprot ID | W6QQQ0 |
Locus tag | BN5_RS03090 | Protein ID | WP_039965077.1 |
Coordinates | 688401..688697 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | W6QYQ7 |
Locus tag | BN5_RS03095 | Protein ID | WP_004425059.1 |
Coordinates | 688685..688942 (-) | Length | 86 a.a. |
Genomic Context
Location: 683461..684900 (1440 bp)
Type: Others
Protein ID: WP_004425078.1
Type: Others
Protein ID: WP_004425078.1
Location: 684903..685910 (1008 bp)
Type: Others
Protein ID: WP_004425076.1
Type: Others
Protein ID: WP_004425076.1
Location: 686107..686253 (147 bp)
Type: Others
Protein ID: WP_004425073.1
Type: Others
Protein ID: WP_004425073.1
Location: 686324..687078 (755 bp)
Type: Others
Protein ID: Protein_619
Type: Others
Protein ID: Protein_619
Location: 687078..688397 (1320 bp)
Type: Others
Protein ID: WP_004425062.1
Type: Others
Protein ID: WP_004425062.1
Location: 690379..691155 (777 bp)
Type: Others
Protein ID: WP_004425053.1
Type: Others
Protein ID: WP_004425053.1
Location: 692422..692670 (249 bp)
Type: Others
Protein ID: WP_004425048.1
Type: Others
Protein ID: WP_004425048.1
Location: 692739..693017 (279 bp)
Type: Others
Protein ID: WP_004425044.1
Type: Others
Protein ID: WP_004425044.1
Location: 688401..688697 (297 bp)
Type: Toxin
Protein ID: WP_039965077.1
Type: Toxin
Protein ID: WP_039965077.1
Location: 688685..688942 (258 bp)
Type: Antitoxin
Protein ID: WP_004425059.1
Type: Antitoxin
Protein ID: WP_004425059.1
Location: 689011..690135 (1125 bp)
Type: Others
Protein ID: WP_004425056.1
Type: Others
Protein ID: WP_004425056.1
Location: 691156..692181 (1026 bp)
Type: Others
Protein ID: WP_004425051.1
Type: Others
Protein ID: WP_004425051.1
Location: 693279..693755 (477 bp)
Type: Others
Protein ID: WP_039965075.1
Type: Others
Protein ID: WP_039965075.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN5_RS03065 | 683461..684900 | + | 1440 | WP_004425078.1 | cytochrome ubiquinol oxidase subunit I | - |
BN5_RS03070 | 684903..685910 | + | 1008 | WP_004425076.1 | cytochrome d ubiquinol oxidase subunit II | - |
BN5_RS03075 | 686107..686253 | + | 147 | WP_004425073.1 | DUF2474 domain-containing protein | - |
BN5_RS22185 | 686324..687078 | + | 755 | Protein_619 | hypothetical protein | - |
BN5_RS03085 | 687078..688397 | + | 1320 | WP_004425062.1 | Zn-dependent protease | - |
BN5_RS03090 | 688401..688697 | - | 297 | WP_039965077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN5_RS03095 | 688685..688942 | - | 258 | WP_004425059.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
BN5_RS03100 | 689011..690135 | - | 1125 | WP_004425056.1 | class I SAM-dependent methyltransferase | - |
BN5_RS03105 | 690379..691155 | + | 777 | WP_004425053.1 | ferredoxin--NADP reductase | - |
BN5_RS03110 | 691156..692181 | - | 1026 | WP_004425051.1 | hemolysin family protein | - |
BN5_RS03115 | 692422..692670 | + | 249 | WP_004425048.1 | YdcH family protein | - |
BN5_RS03120 | 692739..693017 | + | 279 | WP_004425044.1 | DUF465 domain-containing protein | - |
BN5_RS03125 | 693279..693755 | - | 477 | WP_039965075.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11393.23 Da Isoelectric Point: 5.5623
>T285126 WP_039965077.1 NZ_HG916826:c688697-688401 [Pseudomonas pseudoalcaligenes CECT 5344]
MAEIVWTNTALEQLDDLAHYIALDKPDAARALVMRAVETVSRLADFPLSGRVPDELPHSVYREIVIPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE
MAEIVWTNTALEQLDDLAHYIALDKPDAARALVMRAVETVSRLADFPLSGRVPDELPHSVYREIVIPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE
Download Length: 297 bp