Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 688401..688942 Replicon chromosome
Accession NZ_HG916826
Organism Pseudomonas pseudoalcaligenes CECT 5344 strain CECT5344

Toxin (Protein)


Gene name relE Uniprot ID W6QQQ0
Locus tag BN5_RS03090 Protein ID WP_039965077.1
Coordinates 688401..688697 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID W6QYQ7
Locus tag BN5_RS03095 Protein ID WP_004425059.1
Coordinates 688685..688942 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN5_RS03065 683461..684900 + 1440 WP_004425078.1 cytochrome ubiquinol oxidase subunit I -
BN5_RS03070 684903..685910 + 1008 WP_004425076.1 cytochrome d ubiquinol oxidase subunit II -
BN5_RS03075 686107..686253 + 147 WP_004425073.1 DUF2474 domain-containing protein -
BN5_RS22185 686324..687078 + 755 Protein_619 hypothetical protein -
BN5_RS03085 687078..688397 + 1320 WP_004425062.1 Zn-dependent protease -
BN5_RS03090 688401..688697 - 297 WP_039965077.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
BN5_RS03095 688685..688942 - 258 WP_004425059.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
BN5_RS03100 689011..690135 - 1125 WP_004425056.1 class I SAM-dependent methyltransferase -
BN5_RS03105 690379..691155 + 777 WP_004425053.1 ferredoxin--NADP reductase -
BN5_RS03110 691156..692181 - 1026 WP_004425051.1 hemolysin family protein -
BN5_RS03115 692422..692670 + 249 WP_004425048.1 YdcH family protein -
BN5_RS03120 692739..693017 + 279 WP_004425044.1 DUF465 domain-containing protein -
BN5_RS03125 693279..693755 - 477 WP_039965075.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-73)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11393.23 Da        Isoelectric Point: 5.5623

>T285126 WP_039965077.1 NZ_HG916826:c688697-688401 [Pseudomonas pseudoalcaligenes CECT 5344]
MAEIVWTNTALEQLDDLAHYIALDKPDAARALVMRAVETVSRLADFPLSGRVPDELPHSVYREIVIPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE

Download         Length: 297 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9715.23 Da        Isoelectric Point: 7.3181

>AT285126 WP_004425059.1 NZ_HG916826:c688942-688685 [Pseudomonas pseudoalcaligenes CECT 5344]
MKVELVTNLKRQATKILADLHESKEPVLITEHGMPSAYLVDVDDYQFMQKRLALLDALARGERAVIEGNTANHEQAKERL
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W6QQQ0

Antitoxin

Source ID Structure
AlphaFold DB W6QYQ7

References