Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1727589..1728118 | Replicon | chromosome |
Accession | NZ_HG813242 | ||
Organism | Staphylococcus epidermidis PM221 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | SEB_RS08230 | Protein ID | WP_001829891.1 |
Coordinates | 1727589..1727951 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | SEB_RS08235 | Protein ID | WP_001829931.1 |
Coordinates | 1727948..1728118 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SEB_RS08210 | 1724591..1725361 | - | 771 | WP_002440602.1 | RNA polymerase sigma factor SigB | - |
SEB_RS08215 | 1725336..1725815 | - | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
SEB_RS08220 | 1725817..1726143 | - | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
SEB_RS08225 | 1726243..1727244 | - | 1002 | WP_038399520.1 | PP2C family protein-serine/threonine phosphatase | - |
SEB_RS08230 | 1727589..1727951 | - | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
SEB_RS08235 | 1727948..1728118 | - | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
SEB_RS08240 | 1728205..1729353 | - | 1149 | WP_002457107.1 | alanine racemase | - |
SEB_RS08245 | 1729420..1729773 | - | 354 | WP_002457108.1 | holo-ACP synthase | - |
SEB_RS08250 | 1729821..1730330 | - | 510 | WP_002457109.1 | PH domain-containing protein | - |
SEB_RS08255 | 1730317..1731822 | - | 1506 | WP_002457110.1 | PH domain-containing protein | - |
SEB_RS08260 | 1731815..1732294 | - | 480 | WP_002457111.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T285114 WP_001829891.1 NZ_HG813242:c1727951-1727589 [Staphylococcus epidermidis PM221]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |