Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Txe-YefM |
Location | 3768174..3768703 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TI95 |
Locus tag | MT49_RS17715 | Protein ID | WP_003417760.1 |
Coordinates | 3768446..3768703 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0TI94 |
Locus tag | MT49_RS17710 | Protein ID | WP_003417757.1 |
Coordinates | 3768174..3768449 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS22820 | 3764972..3766409 | - | 1438 | Protein_3457 | FAD-binding oxidoreductase | - |
MT49_RS17695 | 3766512..3766901 | + | 390 | WP_003417745.1 | DUF732 domain-containing protein | - |
MT49_RS17700 | 3766915..3767208 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
MT49_RS17705 | 3767205..3768050 | - | 846 | WP_003417751.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
MT49_RS17710 | 3768174..3768449 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
MT49_RS17715 | 3768446..3768703 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
MT49_RS17720 | 3768745..3769935 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
MT49_RS17725 | 3770052..3770420 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
MT49_RS17730 | 3770417..3770968 | - | 552 | WP_003417767.1 | pentapeptide repeat protein MfpA | - |
MT49_RS17735 | 3770975..3771556 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
MT49_RS17740 | 3771537..3771905 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
MT49_RS17745 | 3771883..3772275 | - | 393 | WP_003417776.1 | roadblock/LC7 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T285110 WP_003417760.1 NZ_HG813240:3768446-3768703 [Mycobacterium tuberculosis 49-02]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|