Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3699310..3699984 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | MT49_RS17500 | Protein ID | WP_003417282.1 |
Coordinates | 3699310..3699738 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | MT49_RS17505 | Protein ID | WP_003417286.1 |
Coordinates | 3699742..3699984 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS17475 | 3695132..3695533 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
MT49_RS17480 | 3695674..3696108 | + | 435 | WP_003900017.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
MT49_RS17485 | 3696105..3696539 | + | 435 | WP_003902441.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
MT49_RS17490 | 3696668..3698440 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
MT49_RS17495 | 3698440..3699231 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
MT49_RS17500 | 3699310..3699738 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS17505 | 3699742..3699984 | - | 243 | WP_003417286.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MT49_RS17510 | 3700106..3700720 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
MT49_RS17515 | 3700717..3701382 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
MT49_RS17520 | 3701383..3701916 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
MT49_RS17525 | 3701913..3702287 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
MT49_RS17530 | 3702384..3703448 | - | 1065 | WP_003913037.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T285109 WP_003417282.1 NZ_HG813240:c3699738-3699310 [Mycobacterium tuberculosis 49-02]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |