Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3699310..3699984 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag MT49_RS17500 Protein ID WP_003417282.1
Coordinates 3699310..3699738 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag MT49_RS17505 Protein ID WP_003417286.1
Coordinates 3699742..3699984 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS17475 3695132..3695533 - 402 WP_003417264.1 cytidine deaminase -
MT49_RS17480 3695674..3696108 + 435 WP_003900017.1 succinate dehydrogenase, cytochrome b556 subunit -
MT49_RS17485 3696105..3696539 + 435 WP_003902441.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
MT49_RS17490 3696668..3698440 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
MT49_RS17495 3698440..3699231 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
MT49_RS17500 3699310..3699738 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS17505 3699742..3699984 - 243 WP_003417286.1 ribbon-helix-helix domain-containing protein Antitoxin
MT49_RS17510 3700106..3700720 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
MT49_RS17515 3700717..3701382 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
MT49_RS17520 3701383..3701916 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
MT49_RS17525 3701913..3702287 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
MT49_RS17530 3702384..3703448 - 1065 WP_003913037.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T285109 WP_003417282.1 NZ_HG813240:c3699738-3699310 [Mycobacterium tuberculosis 49-02]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT285109 WP_003417286.1 NZ_HG813240:c3699984-3699742 [Mycobacterium tuberculosis 49-02]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References