Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3171130..3171817 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | MT49_RS15110 | Protein ID | WP_003414624.1 |
Coordinates | 3171374..3171817 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | MT49_RS15105 | Protein ID | WP_003414620.1 |
Coordinates | 3171130..3171387 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS15085 | 3166450..3167304 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
MT49_RS15090 | 3167360..3168523 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
MT49_RS15095 | 3168540..3169754 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
MT49_RS15100 | 3169762..3171003 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
MT49_RS15105 | 3171130..3171387 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MT49_RS15110 | 3171374..3171817 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS15115 | 3171897..3172559 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
MT49_RS15120 | 3172655..3172846 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MT49_RS15125 | 3173178..3174926 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
MT49_RS15130 | 3175022..3175603 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
MT49_RS15135 | 3175703..3175969 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T285107 WP_003414624.1 NZ_HG813240:3171374-3171817 [Mycobacterium tuberculosis 49-02]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|