285105

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3124612..3125216 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag MT49_RS14880 Protein ID WP_003414492.1
Coordinates 3124612..3125004 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag MT49_RS14885 Protein ID WP_003414495.1
Coordinates 3125001..3125216 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS14850 3119762..3120550 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
MT49_RS14855 3120884..3121429 - 546 WP_014584866.1 DUF1802 family protein -
MT49_RS14860 3121701..3122585 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
MT49_RS14865 3122588..3123475 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
MT49_RS14870 3123780..3124325 - 546 WP_003910939.1 DUF1802 family protein -
MT49_RS14875 3124322..3124591 - 270 WP_003414489.1 DUF2277 family protein -
MT49_RS14880 3124612..3125004 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS14885 3125001..3125216 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MT49_RS14890 3125263..3126012 + 750 WP_003902358.1 enoyl-CoA hydratase -
MT49_RS14895 3126091..3127173 - 1083 WP_003414499.1 ABC transporter ATP-binding protein -
MT49_RS14900 3127166..3128476 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
MT49_RS14905 3128479..3129306 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
MT49_RS14910 3129303..3130214 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T285105 WP_003414492.1 NZ_HG813240:c3125004-3124612 [Mycobacterium tuberculosis 49-02]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT285105 WP_003414495.1 NZ_HG813240:c3125216-3125001 [Mycobacterium tuberculosis 49-02]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References