Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3104414..3104984 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | MT49_RS14750 | Protein ID | WP_003414166.1 |
| Coordinates | 3104414..3104770 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | MT49_RS14755 | Protein ID | WP_003901465.1 |
| Coordinates | 3104754..3104984 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS14730 | 3099866..3101554 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| MT49_RS14735 | 3101558..3101884 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| MT49_RS14740 | 3102057..3102644 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
| MT49_RS14745 | 3102663..3104312 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| MT49_RS14750 | 3104414..3104770 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| MT49_RS14755 | 3104754..3104984 | - | 231 | WP_003901465.1 | antitoxin MazE | Antitoxin |
| MT49_RS14760 | 3105027..3106070 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| MT49_RS22240 | 3106261..3106536 | + | 276 | WP_003911993.1 | DUF1778 domain-containing protein | - |
| MT49_RS22540 | 3106712..3106966 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| MT49_RS14775 | 3107114..3107518 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| MT49_RS14780 | 3107515..3107706 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| MT49_RS14785 | 3107770..3109059 | + | 1290 | Protein_2891 | transposase family protein | - |
| MT49_RS14790 | 3109293..3109550 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| MT49_RS14795 | 3109655..3109966 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T285103 WP_003414166.1 NZ_HG813240:c3104770-3104414 [Mycobacterium tuberculosis 49-02]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|