Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3064830..3065517 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TF65 |
Locus tag | MT49_RS14540 | Protein ID | WP_003414064.1 |
Coordinates | 3065122..3065517 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | MT49_RS14535 | Protein ID | WP_003414061.1 |
Coordinates | 3064830..3065096 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS14510 | 3060469..3061371 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
MT49_RS14515 | 3061440..3062192 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
MT49_RS14520 | 3062436..3062711 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
MT49_RS14525 | 3062708..3064330 | - | 1623 | WP_003414057.1 | type I restriction-modification system subunit M | - |
MT49_RS14530 | 3064417..3064833 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
MT49_RS14535 | 3064830..3065096 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MT49_RS14540 | 3065122..3065517 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS14545 | 3065514..3065783 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MT49_RS14550 | 3065793..3066887 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
MT49_RS14555 | 3066884..3067303 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
MT49_RS14560 | 3067377..3067856 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
MT49_RS14565 | 3067927..3068727 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
MT49_RS14570 | 3068883..3069620 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T285102 WP_003414064.1 NZ_HG813240:c3065517-3065122 [Mycobacterium tuberculosis 49-02]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|