Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3064830..3065517 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag MT49_RS14540 Protein ID WP_003414064.1
Coordinates 3065122..3065517 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag MT49_RS14535 Protein ID WP_003414061.1
Coordinates 3064830..3065096 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS14510 3060469..3061371 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
MT49_RS14515 3061440..3062192 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
MT49_RS14520 3062436..3062711 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
MT49_RS14525 3062708..3064330 - 1623 WP_003414057.1 type I restriction-modification system subunit M -
MT49_RS14530 3064417..3064833 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
MT49_RS14535 3064830..3065096 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MT49_RS14540 3065122..3065517 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS14545 3065514..3065783 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
MT49_RS14550 3065793..3066887 - 1095 WP_003414068.1 restriction endonuclease subunit S -
MT49_RS14555 3066884..3067303 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
MT49_RS14560 3067377..3067856 - 480 WP_003414073.1 dihydrofolate reductase -
MT49_RS14565 3067927..3068727 - 801 WP_003911953.1 thymidylate synthase -
MT49_RS14570 3068883..3069620 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T285102 WP_003414064.1 NZ_HG813240:c3065517-3065122 [Mycobacterium tuberculosis 49-02]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT285102 WP_003414061.1 NZ_HG813240:c3065096-3064830 [Mycobacterium tuberculosis 49-02]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References