Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2925500..2926214 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | MT49_RS13735 | Protein ID | WP_003413460.1 |
Coordinates | 2925774..2926214 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | MT49_RS13730 | Protein ID | WP_003413456.1 |
Coordinates | 2925500..2925787 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS13695 | 2920922..2921167 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MT49_RS13700 | 2921164..2921568 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
MT49_RS13705 | 2921785..2922405 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
MT49_RS13710 | 2922416..2922910 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
MT49_RS13715 | 2922907..2923338 | + | 432 | WP_003899390.1 | DUF4247 domain-containing protein | - |
MT49_RS13720 | 2923363..2923821 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
MT49_RS13725 | 2923818..2925389 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
MT49_RS13730 | 2925500..2925787 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
MT49_RS13735 | 2925774..2926214 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS13740 | 2926235..2926990 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
MT49_RS13745 | 2927123..2927719 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
MT49_RS13750 | 2927727..2928572 | - | 846 | WP_003413466.1 | acyl-CoA thioesterase II | - |
MT49_RS13755 | 2928601..2929500 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
MT49_RS13760 | 2929628..2930302 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T285099 WP_003413460.1 NZ_HG813240:2925774-2926214 [Mycobacterium tuberculosis 49-02]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |