Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2925500..2926214 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag MT49_RS13735 Protein ID WP_003413460.1
Coordinates 2925774..2926214 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag MT49_RS13730 Protein ID WP_003413456.1
Coordinates 2925500..2925787 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS13695 2920922..2921167 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MT49_RS13700 2921164..2921568 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
MT49_RS13705 2921785..2922405 + 621 WP_003413441.1 DUF4178 domain-containing protein -
MT49_RS13710 2922416..2922910 + 495 WP_003413444.1 DUF2617 family protein -
MT49_RS13715 2922907..2923338 + 432 WP_003899390.1 DUF4247 domain-containing protein -
MT49_RS13720 2923363..2923821 + 459 WP_003413451.1 DUF350 domain-containing protein -
MT49_RS13725 2923818..2925389 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
MT49_RS13730 2925500..2925787 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
MT49_RS13735 2925774..2926214 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS13740 2926235..2926990 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
MT49_RS13745 2927123..2927719 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
MT49_RS13750 2927727..2928572 - 846 WP_003413466.1 acyl-CoA thioesterase II -
MT49_RS13755 2928601..2929500 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
MT49_RS13760 2929628..2930302 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T285099 WP_003413460.1 NZ_HG813240:2925774-2926214 [Mycobacterium tuberculosis 49-02]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT285099 WP_003413456.1 NZ_HG813240:2925500-2925787 [Mycobacterium tuberculosis 49-02]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References