Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2864037..2864668 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ28 |
| Locus tag | MT49_RS13460 | Protein ID | WP_003413174.1 |
| Coordinates | 2864291..2864668 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | MT49_RS13455 | Protein ID | WP_003413167.1 |
| Coordinates | 2864037..2864294 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS13430 | 2859952..2860266 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| MT49_RS13435 | 2860562..2861773 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| MT49_RS13440 | 2861900..2862559 | + | 660 | WP_003902296.1 | hypothetical protein | - |
| MT49_RS13445 | 2862556..2863218 | + | 663 | WP_003905878.1 | hypothetical protein | - |
| MT49_RS22230 | 2863215..2863492 | + | 278 | Protein_2622 | type II toxin-antitoxin system VapB family antitoxin | - |
| MT49_RS13450 | 2863585..2863998 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
| MT49_RS13455 | 2864037..2864294 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MT49_RS13460 | 2864291..2864668 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MT49_RS13465 | 2864684..2865058 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| MT49_RS13470 | 2865158..2865553 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| MT49_RS13475 | 2865550..2865795 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| MT49_RS13480 | 2866206..2866625 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| MT49_RS13485 | 2866637..2867446 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
| MT49_RS13490 | 2867443..2868696 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| MT49_RS13495 | 2868689..2869201 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T285097 WP_003413174.1 NZ_HG813240:2864291-2864668 [Mycobacterium tuberculosis 49-02]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |