Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2864037..2864668 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag MT49_RS13460 Protein ID WP_003413174.1
Coordinates 2864291..2864668 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag MT49_RS13455 Protein ID WP_003413167.1
Coordinates 2864037..2864294 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS13430 2859952..2860266 + 315 WP_009937839.1 hypothetical protein -
MT49_RS13435 2860562..2861773 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
MT49_RS13440 2861900..2862559 + 660 WP_003902296.1 hypothetical protein -
MT49_RS13445 2862556..2863218 + 663 WP_003905878.1 hypothetical protein -
MT49_RS22230 2863215..2863492 + 278 Protein_2622 type II toxin-antitoxin system VapB family antitoxin -
MT49_RS13450 2863585..2863998 + 414 WP_003413164.1 PIN domain nuclease -
MT49_RS13455 2864037..2864294 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
MT49_RS13460 2864291..2864668 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS13465 2864684..2865058 - 375 WP_003413177.1 hypothetical protein -
MT49_RS13470 2865158..2865553 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
MT49_RS13475 2865550..2865795 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
MT49_RS13480 2866206..2866625 - 420 WP_003413190.1 A24 family peptidase -
MT49_RS13485 2866637..2867446 - 810 WP_003413193.1 shikimate dehydrogenase -
MT49_RS13490 2867443..2868696 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
MT49_RS13495 2868689..2869201 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T285097 WP_003413174.1 NZ_HG813240:2864291-2864668 [Mycobacterium tuberculosis 49-02]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT285097 WP_003413167.1 NZ_HG813240:2864037-2864294 [Mycobacterium tuberculosis 49-02]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References