Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2849699..2850339 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | MT49_RS13370 | Protein ID | WP_003412970.1 |
Coordinates | 2849699..2850118 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | MT49_RS13375 | Protein ID | WP_003412975.1 |
Coordinates | 2850115..2850339 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS13345 | 2845289..2846011 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
MT49_RS13350 | 2846528..2846750 | + | 223 | Protein_2601 | type II toxin-antitoxin system VapB family antitoxin | - |
MT49_RS13355 | 2846747..2847148 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
MT49_RS13360 | 2847183..2848103 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
MT49_RS22530 | 2848444..2848689 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MT49_RS13365 | 2848748..2849698 | + | 951 | WP_003911916.1 | Lsr2 family protein | - |
MT49_RS13370 | 2849699..2850118 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS13375 | 2850115..2850339 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
MT49_RS13380 | 2850370..2853213 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
MT49_RS13385 | 2853285..2853686 | - | 402 | WP_003412981.1 | hypothetical protein | - |
MT49_RS13390 | 2853686..2854156 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
MT49_RS13395 | 2854159..2854722 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T285095 WP_003412970.1 NZ_HG813240:c2850118-2849699 [Mycobacterium tuberculosis 49-02]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|