Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2849699..2850339 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag MT49_RS13370 Protein ID WP_003412970.1
Coordinates 2849699..2850118 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag MT49_RS13375 Protein ID WP_003412975.1
Coordinates 2850115..2850339 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS13345 2845289..2846011 - 723 WP_003412957.1 DUF1906 domain-containing protein -
MT49_RS13350 2846528..2846750 + 223 Protein_2601 type II toxin-antitoxin system VapB family antitoxin -
MT49_RS13355 2846747..2847148 + 402 WP_003412963.1 PIN domain-containing protein -
MT49_RS13360 2847183..2848103 - 921 WP_003412965.1 restriction endonuclease -
MT49_RS22530 2848444..2848689 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MT49_RS13365 2848748..2849698 + 951 WP_003911916.1 Lsr2 family protein -
MT49_RS13370 2849699..2850118 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS13375 2850115..2850339 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
MT49_RS13380 2850370..2853213 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
MT49_RS13385 2853285..2853686 - 402 WP_003412981.1 hypothetical protein -
MT49_RS13390 2853686..2854156 - 471 WP_003899364.1 transcription antitermination factor NusB -
MT49_RS13395 2854159..2854722 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T285095 WP_003412970.1 NZ_HG813240:c2850118-2849699 [Mycobacterium tuberculosis 49-02]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT285095 WP_003412975.1 NZ_HG813240:c2850339-2850115 [Mycobacterium tuberculosis 49-02]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References