Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2803520..2804172 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A5R1ZCY8 |
Locus tag | MT49_RS13170 | Protein ID | WP_003905869.1 |
Coordinates | 2803747..2804172 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | MT49_RS13165 | Protein ID | WP_003412749.1 |
Coordinates | 2803520..2803741 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS13150 | 2801760..2801966 | - | 207 | WP_003899347.1 | hypothetical protein | - |
MT49_RS13155 | 2802102..2802725 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
MT49_RS13160 | 2802715..2803467 | + | 753 | WP_003901416.1 | hypothetical protein | - |
MT49_RS13165 | 2803520..2803741 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
MT49_RS13170 | 2803747..2804172 | + | 426 | WP_003905869.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS13175 | 2804195..2805376 | - | 1182 | WP_003905870.1 | 2-oxo acid dehydrogenase subunit E2 | - |
MT49_RS13180 | 2805373..2806419 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
MT49_RS13185 | 2806430..2807533 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
MT49_RS13190 | 2807792..2808613 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
MT49_RS13195 | 2808610..2809167 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15364.84 Da Isoelectric Point: 9.2386
>T285094 WP_003905869.1 NZ_HG813240:2803747-2804172 [Mycobacterium tuberculosis 49-02]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRASTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRASTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5R1ZCY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |