Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2400951..2401480 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag MT49_RS11265 Protein ID WP_003411124.1
Coordinates 2400951..2401268 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag MT49_RS11270 Protein ID WP_003411127.1
Coordinates 2401265..2401480 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS11235 2395972..2397048 + 1077 WP_003411110.1 hypothetical protein -
MT49_RS11240 2397045..2397326 + 282 WP_003411112.1 hypothetical protein -
MT49_RS11245 2397362..2398435 + 1074 WP_003901338.1 quinone-dependent dihydroorotate dehydrogenase -
MT49_RS11250 2398440..2398970 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
MT49_RS11255 2399018..2400364 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
MT49_RS11265 2400951..2401268 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MT49_RS11270 2401265..2401480 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
MT49_RS11275 2401735..2402793 + 1059 WP_003411129.1 hypothetical protein -
MT49_RS11280 2402923..2403279 - 357 WP_003411130.1 hypothetical protein -
MT49_RS11285 2403374..2404156 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
MT49_RS11290 2404424..2404714 - 291 WP_003900476.1 YggT family protein -
MT49_RS11295 2404876..2405532 - 657 WP_003411133.1 cell division protein SepF -
MT49_RS11300 2405594..2406373 - 780 WP_015575160.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T285093 WP_003411124.1 NZ_HG813240:c2401268-2400951 [Mycobacterium tuberculosis 49-02]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT285093 WP_003411127.1 NZ_HG813240:c2401480-2401265 [Mycobacterium tuberculosis 49-02]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References