Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/- |
Location | 2400951..2401480 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | parE | Uniprot ID | G0TMR4 |
Locus tag | MT49_RS11265 | Protein ID | WP_003411124.1 |
Coordinates | 2400951..2401268 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P9WJ74 |
Locus tag | MT49_RS11270 | Protein ID | WP_003411127.1 |
Coordinates | 2401265..2401480 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS11235 | 2395972..2397048 | + | 1077 | WP_003411110.1 | hypothetical protein | - |
MT49_RS11240 | 2397045..2397326 | + | 282 | WP_003411112.1 | hypothetical protein | - |
MT49_RS11245 | 2397362..2398435 | + | 1074 | WP_003901338.1 | quinone-dependent dihydroorotate dehydrogenase | - |
MT49_RS11250 | 2398440..2398970 | - | 531 | WP_003411119.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
MT49_RS11255 | 2399018..2400364 | - | 1347 | WP_003411121.1 | M20/M25/M40 family metallo-hydrolase | - |
MT49_RS11265 | 2400951..2401268 | - | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MT49_RS11270 | 2401265..2401480 | - | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
MT49_RS11275 | 2401735..2402793 | + | 1059 | WP_003411129.1 | hypothetical protein | - |
MT49_RS11280 | 2402923..2403279 | - | 357 | WP_003411130.1 | hypothetical protein | - |
MT49_RS11285 | 2403374..2404156 | - | 783 | WP_003411131.1 | cell wall synthesis protein Wag31 | - |
MT49_RS11290 | 2404424..2404714 | - | 291 | WP_003900476.1 | YggT family protein | - |
MT49_RS11295 | 2404876..2405532 | - | 657 | WP_003411133.1 | cell division protein SepF | - |
MT49_RS11300 | 2405594..2406373 | - | 780 | WP_015575160.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T285093 WP_003411124.1 NZ_HG813240:c2401268-2400951 [Mycobacterium tuberculosis 49-02]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAJ4 |