Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 2248840..2249466 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P64926 |
| Locus tag | MT49_RS10520 | Protein ID | WP_003410075.1 |
| Coordinates | 2249068..2249466 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A806JLL8 |
| Locus tag | MT49_RS10515 | Protein ID | WP_003911750.1 |
| Coordinates | 2248840..2249067 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS10505 | 2246879..2247223 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
| MT49_RS10510 | 2247412..2248581 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
| MT49_RS10515 | 2248840..2249067 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MT49_RS10520 | 2249068..2249466 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
| MT49_RS10525 | 2249649..2250080 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| MT49_RS10530 | 2250181..2250615 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
| MT49_RS21355 | 2251052..2251231 | - | 180 | Protein_2064 | hypothetical protein | - |
| MT49_RS10535 | 2251292..2251939 | + | 648 | WP_071854215.1 | transposase | - |
| MT49_RS10540 | 2251893..2252483 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
| MT49_RS10545 | 2252611..2253867 | - | 1257 | WP_003902247.1 | HNH endonuclease | - |
| MT49_RS10550 | 2254221..2254421 | + | 201 | Protein_2068 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T285089 WP_003410075.1 NZ_HG813240:2249068-2249466 [Mycobacterium tuberculosis 49-02]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|