Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2216209..2216897 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | MT49_RS10350 | Protein ID | WP_003409958.1 |
Coordinates | 2216209..2216628 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | MT49_RS10355 | Protein ID | WP_003409968.1 |
Coordinates | 2216637..2216897 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS10330 | 2211704..2212552 | + | 849 | WP_003901306.1 | class I SAM-dependent methyltransferase | - |
MT49_RS10335 | 2212515..2213960 | - | 1446 | WP_003899115.1 | APC family permease | - |
MT49_RS10340 | 2214139..2214825 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
MT49_RS10345 | 2215016..2215984 | - | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
MT49_RS10350 | 2216209..2216628 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS10355 | 2216637..2216897 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MT49_RS10360 | 2217040..2218716 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
MT49_RS10365 | 2218704..2219357 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
MT49_RS10370 | 2219472..2219702 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
MT49_RS10375 | 2219787..2220698 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
MT49_RS10380 | 2220807..2221406 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T285086 WP_003409958.1 NZ_HG813240:c2216628-2216209 [Mycobacterium tuberculosis 49-02]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |