285085

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2189986..2190530 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MT49_RS10190 Protein ID WP_003409896.1
Coordinates 2189986..2190282 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MT49_RS10195 Protein ID WP_003409899.1
Coordinates 2190279..2190530 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS10135 2185019..2185369 - 351 WP_003409871.1 hypothetical protein -
MT49_RS10140 2185380..2186282 - 903 WP_003899097.1 hypothetical protein -
MT49_RS10145 2186303..2186494 - 192 WP_003409876.1 hypothetical protein -
MT49_RS10150 2186495..2186791 - 297 WP_003409877.1 hypothetical protein -
MT49_RS10155 2187031..2187246 + 216 WP_003409878.1 antitoxin -
MT49_RS10160 2187243..2187554 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MT49_RS22495 2187528..2188049 - 522 WP_003904745.1 hypothetical protein -
MT49_RS10170 2188024..2188401 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MT49_RS10175 2188443..2188892 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MT49_RS10180 2188889..2189434 + 546 WP_003409891.1 SecB-like chaperone -
MT49_RS10185 2189323..2189937 - 615 WP_003901296.1 hypothetical protein -
MT49_RS10190 2189986..2190282 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MT49_RS10195 2190279..2190530 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MT49_RS10200 2190517..2191011 + 495 WP_003899099.1 hypothetical protein -
MT49_RS10205 2191171..2191578 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MT49_RS10210 2191582..2191854 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MT49_RS10215 2191887..2193107 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MT49_RS10225 2194006..2194803 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T285085 WP_003409896.1 NZ_HG813240:c2190282-2189986 [Mycobacterium tuberculosis 49-02]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT285085 WP_003409899.1 NZ_HG813240:c2190530-2190279 [Mycobacterium tuberculosis 49-02]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References