Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1961903..1962363 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TKL9 |
| Locus tag | MT49_RS09130 | Protein ID | WP_003898996.1 |
| Coordinates | 1962115..1962363 (+) | Length | 83 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ30 |
| Locus tag | MT49_RS09125 | Protein ID | WP_003408528.1 |
| Coordinates | 1961903..1962115 (+) | Length | 71 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS09110 | 1958381..1959568 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
| MT49_RS09115 | 1959855..1960139 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
| MT49_RS09120 | 1960153..1961835 | - | 1683 | WP_003901239.1 | SulP family inorganic anion transporter | - |
| MT49_RS09125 | 1961903..1962115 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MT49_RS09130 | 1962115..1962363 | + | 249 | WP_003898996.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MT49_RS09135 | 1962371..1963108 | + | 738 | WP_003898997.1 | hypothetical protein | - |
| MT49_RS09140 | 1963202..1964902 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
| MT49_RS09145 | 1965187..1965588 | - | 402 | WP_003408538.1 | hypothetical protein | - |
| MT49_RS09150 | 1965578..1966189 | - | 612 | WP_003898999.1 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8884.14 Da Isoelectric Point: 4.1074
>T285082 WP_003898996.1 NZ_HG813240:1962115-1962363 [Mycobacterium tuberculosis 49-02]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYKGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYKGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TKL9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CFE8 |