Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1689538..1690154 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | MT49_RS07940 | Protein ID | WP_003407593.1 |
| Coordinates | 1689837..1690154 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | MT49_RS07935 | Protein ID | WP_003900349.1 |
| Coordinates | 1689538..1689840 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS07925 | 1685424..1687271 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
| MT49_RS07930 | 1687272..1689524 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| MT49_RS07935 | 1689538..1689840 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| MT49_RS07940 | 1689837..1690154 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| MT49_RS07945 | 1690151..1691155 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| MT49_RS07950 | 1691208..1692497 | + | 1290 | WP_003902090.1 | serine hydrolase | - |
| MT49_RS07955 | 1692570..1693343 | - | 774 | WP_003912632.1 | class I SAM-dependent methyltransferase | - |
| MT49_RS07960 | 1693401..1693613 | - | 213 | WP_003898900.1 | dodecin family protein | - |
| MT49_RS22475 | 1693623..1693847 | - | 225 | WP_160522526.1 | NUDIX domain-containing protein | - |
| MT49_RS07970 | 1694117..1695145 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T285079 WP_003407593.1 NZ_HG813240:1689837-1690154 [Mycobacterium tuberculosis 49-02]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|