Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1384260..1384948 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0THR7 |
Locus tag | MT49_RS06575 | Protein ID | WP_003406304.1 |
Coordinates | 1384517..1384948 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0THR6 |
Locus tag | MT49_RS06570 | Protein ID | WP_003406302.1 |
Coordinates | 1384260..1384520 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS06550 | 1379837..1380661 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
MT49_RS06555 | 1380666..1381847 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
MT49_RS06560 | 1381924..1383024 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
MT49_RS06565 | 1383195..1384184 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
MT49_RS06570 | 1384260..1384520 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
MT49_RS06575 | 1384517..1384948 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS06580 | 1384971..1386554 | - | 1584 | WP_009940130.1 | PE family protein | - |
MT49_RS06585 | 1386734..1387594 | + | 861 | WP_003900301.1 | hypothetical protein | - |
MT49_RS06590 | 1387675..1388505 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
MT49_RS06595 | 1388562..1388855 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
MT49_RS06600 | 1388852..1389121 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T285075 WP_003406304.1 NZ_HG813240:1384517-1384948 [Mycobacterium tuberculosis 49-02]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|