Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1238036..1238604 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TH08 |
Locus tag | MT49_RS05900 | Protein ID | WP_003405865.1 |
Coordinates | 1238230..1238604 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TH07 |
Locus tag | MT49_RS05895 | Protein ID | WP_003405863.1 |
Coordinates | 1238036..1238233 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS05875 | 1234077..1234715 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
MT49_RS05880 | 1234805..1235812 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
MT49_RS05885 | 1235829..1236812 | - | 984 | WP_003898731.1 | hypothetical protein | - |
MT49_RS05890 | 1236875..1237948 | + | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
MT49_RS05895 | 1238036..1238233 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MT49_RS05900 | 1238230..1238604 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS05905 | 1238807..1239505 | + | 699 | WP_003898733.1 | hypothetical protein | - |
MT49_RS05910 | 1239623..1239808 | + | 186 | WP_003901093.1 | hypothetical protein | - |
MT49_RS05915 | 1239735..1240010 | - | 276 | WP_003405867.1 | hypothetical protein | - |
MT49_RS05920 | 1240253..1240576 | + | 324 | WP_003405871.1 | antibiotic biosynthesis monooxygenase | - |
MT49_RS05925 | 1240591..1241301 | - | 711 | WP_003911399.1 | hypothetical protein | - |
MT49_RS22685 | 1241323..1241532 | + | 210 | WP_003911400.1 | hypothetical protein | - |
MT49_RS05935 | 1241484..1242191 | - | 708 | Protein_1159 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T285074 WP_003405865.1 NZ_HG813240:1238230-1238604 [Mycobacterium tuberculosis 49-02]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|