Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1238036..1238604 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag MT49_RS05900 Protein ID WP_003405865.1
Coordinates 1238230..1238604 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag MT49_RS05895 Protein ID WP_003405863.1
Coordinates 1238036..1238233 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS05875 1234077..1234715 - 639 WP_003898730.1 lipid droplet-associated protein -
MT49_RS05880 1234805..1235812 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
MT49_RS05885 1235829..1236812 - 984 WP_003898731.1 hypothetical protein -
MT49_RS05890 1236875..1237948 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
MT49_RS05895 1238036..1238233 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MT49_RS05900 1238230..1238604 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS05905 1238807..1239505 + 699 WP_003898733.1 hypothetical protein -
MT49_RS05910 1239623..1239808 + 186 WP_003901093.1 hypothetical protein -
MT49_RS05915 1239735..1240010 - 276 WP_003405867.1 hypothetical protein -
MT49_RS05920 1240253..1240576 + 324 WP_003405871.1 antibiotic biosynthesis monooxygenase -
MT49_RS05925 1240591..1241301 - 711 WP_003911399.1 hypothetical protein -
MT49_RS22685 1241323..1241532 + 210 WP_003911400.1 hypothetical protein -
MT49_RS05935 1241484..1242191 - 708 Protein_1159 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T285074 WP_003405865.1 NZ_HG813240:1238230-1238604 [Mycobacterium tuberculosis 49-02]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT285074 WP_003405863.1 NZ_HG813240:1238036-1238233 [Mycobacterium tuberculosis 49-02]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References