Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1229280..1229911 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | MT49_RS05840 | Protein ID | WP_003405820.1 |
Coordinates | 1229280..1229591 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | MT49_RS05845 | Protein ID | WP_003405836.1 |
Coordinates | 1229591..1229911 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS05820 | 1224761..1226185 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
MT49_RS05825 | 1226216..1227304 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
MT49_RS05830 | 1227360..1228004 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
MT49_RS05835 | 1228011..1229168 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
MT49_RS05840 | 1229280..1229591 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
MT49_RS05845 | 1229591..1229911 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
MT49_RS21050 | 1229921..1231446 | + | 1526 | Protein_1143 | carboxylesterase/lipase family protein | - |
MT49_RS05860 | 1231464..1232576 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
MT49_RS05865 | 1232586..1232843 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
MT49_RS05870 | 1232833..1234080 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
MT49_RS05875 | 1234077..1234715 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T285073 WP_003405820.1 NZ_HG813240:c1229591-1229280 [Mycobacterium tuberculosis 49-02]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Download Length: 107 a.a. Molecular weight: 11394.83 Da Isoelectric Point: 5.1236
>AT285073 WP_003405836.1 NZ_HG813240:c1229911-1229591 [Mycobacterium tuberculosis 49-02]
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
Download Length: 321 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |