Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1013129..1013748 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | MT49_RS04780 | Protein ID | WP_003404726.1 |
Coordinates | 1013314..1013748 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
Locus tag | MT49_RS04775 | Protein ID | WP_003898641.1 |
Coordinates | 1013129..1013308 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS04765 | 1008602..1010182 | + | 1581 | WP_003910977.1 | serine hydrolase | - |
MT49_RS04770 | 1010179..1012572 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
MT49_RS22435 | 1012845..1013003 | + | 159 | WP_003404720.1 | hypothetical protein | - |
MT49_RS04775 | 1013129..1013308 | + | 180 | WP_003898641.1 | antitoxin | Antitoxin |
MT49_RS04780 | 1013314..1013748 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
MT49_RS04785 | 1013846..1014619 | + | 774 | WP_003404735.1 | VOC family protein | - |
MT49_RS04790 | 1014684..1015133 | + | 450 | WP_003404738.1 | hypothetical protein | - |
MT49_RS04795 | 1015268..1015498 | - | 231 | WP_003898642.1 | hypothetical protein | - |
MT49_RS04800 | 1015665..1017173 | - | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
MT49_RS04805 | 1017175..1018413 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T285071 WP_003404726.1 NZ_HG813240:1013314-1013748 [Mycobacterium tuberculosis 49-02]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|