Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 751916..752549 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQD6 |
| Locus tag | MT49_RS03435 | Protein ID | WP_003403365.1 |
| Coordinates | 751916..752299 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ56 |
| Locus tag | MT49_RS03440 | Protein ID | WP_003403368.1 |
| Coordinates | 752394..752549 (-) | Length | 52 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS03410 | 747208..747744 | + | 537 | WP_003403341.1 | 50S ribosomal protein L10 | - |
| MT49_RS03415 | 747781..748173 | + | 393 | WP_003403353.1 | 50S ribosomal protein L7/L12 | - |
| MT49_RS03420 | 748166..748861 | - | 696 | WP_003403355.1 | TetR/AcrR family transcriptional regulator | - |
| MT49_RS03425 | 748932..750437 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
| MT49_RS03430 | 750518..751528 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
| MT49_RS03435 | 751916..752299 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | Toxin |
| MT49_RS03440 | 752394..752549 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MT49_RS03445 | 752625..753341 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
| MT49_RS03450 | 753617..753925 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MT49_RS03455 | 753912..754157 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
| MT49_RS03460 | 754267..754704 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
| MT49_RS03465 | 754701..754955 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
| MT49_RS03470 | 755069..757432 | + | 2364 | WP_003901895.1 | arylsulfatase AtsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13959.73 Da Isoelectric Point: 6.0803
>T285066 WP_003403365.1 NZ_HG813240:c752299-751916 [Mycobacterium tuberculosis 49-02]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSF8 |