Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 716424..717088 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | MT49_RS03265 | Protein ID | WP_003403246.1 |
Coordinates | 716681..717088 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | MT49_RS03260 | Protein ID | WP_003403244.1 |
Coordinates | 716424..716684 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS03235 | 712601..713665 | + | 1065 | WP_003898532.1 | hypothetical protein | - |
MT49_RS03240 | 713769..714716 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
MT49_RS03245 | 714809..715063 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
MT49_RS03250 | 715063..715458 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
MT49_RS03255 | 715552..716292 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
MT49_RS03260 | 716424..716684 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MT49_RS03265 | 716681..717088 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS03270 | 717160..718311 | - | 1152 | WP_003403248.1 | FIST C-terminal domain-containing protein | - |
MT49_RS03275 | 718404..720131 | - | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T285065 WP_003403246.1 NZ_HG813240:716681-717088 [Mycobacterium tuberculosis 49-02]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO | |
AlphaFold DB | A0A7U4BSE4 |