Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 709181..709806 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | MT49_RS03215 | Protein ID | WP_003403218.1 |
| Coordinates | 709405..709806 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | MT49_RS03210 | Protein ID | WP_003403213.1 |
| Coordinates | 709181..709408 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS03180 | 704360..704581 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| MT49_RS03185 | 704723..705328 | + | 606 | WP_003898526.1 | hypothetical protein | - |
| MT49_RS03190 | 705347..707914 | - | 2568 | WP_003901879.1 | SEC-C domain-containing protein | - |
| MT49_RS03195 | 707998..708747 | + | 750 | WP_003898528.1 | hypothetical protein | - |
| MT49_RS03200 | 708744..708986 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| MT49_RS03210 | 709181..709408 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| MT49_RS03215 | 709405..709806 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| MT49_RS20855 | 709935..710630 | + | 696 | WP_003900189.1 | galactose-1-phosphate uridylyltransferase | - |
| MT49_RS20860 | 710627..711118 | + | 492 | WP_003905354.1 | galactose-1-phosphate uridylyltransferase | - |
| MT49_RS03225 | 711115..712206 | + | 1092 | WP_003900977.1 | galactokinase | - |
| MT49_RS03235 | 712601..713665 | + | 1065 | WP_003898532.1 | hypothetical protein | - |
| MT49_RS03240 | 713769..714716 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T285063 WP_003403218.1 NZ_HG813240:709405-709806 [Mycobacterium tuberculosis 49-02]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |