Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 701643..702286 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67239 |
Locus tag | MT49_RS03160 | Protein ID | WP_003403187.1 |
Coordinates | 701885..702286 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ91 |
Locus tag | MT49_RS03155 | Protein ID | WP_003403184.1 |
Coordinates | 701643..701888 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS03120 | 696923..697453 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
MT49_RS03125 | 697437..698132 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
MT49_RS03130 | 698255..698566 | + | 312 | WP_003403164.1 | hypothetical protein | - |
MT49_RS03135 | 698638..699588 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
MT49_RS03140 | 699829..700413 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
MT49_RS03145 | 700415..701128 | + | 714 | Protein_623 | IS607 family element transposase accessory protein TnpB | - |
MT49_RS03150 | 701128..701598 | + | 471 | WP_003898523.1 | hypothetical protein | - |
MT49_RS03155 | 701643..701888 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MT49_RS03160 | 701885..702286 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS22090 | 702674..702841 | - | 168 | WP_077385191.1 | DUF3800 domain-containing protein | - |
MT49_RS22095 | 702874..703071 | - | 198 | WP_003403191.1 | hypothetical protein | - |
MT49_RS03175 | 703151..704308 | - | 1158 | WP_003898524.1 | hypothetical protein | - |
MT49_RS03180 | 704360..704581 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
MT49_RS03185 | 704723..705328 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T285062 WP_003403187.1 NZ_HG813240:701885-702286 [Mycobacterium tuberculosis 49-02]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ91 |