Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 701643..702286 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag MT49_RS03160 Protein ID WP_003403187.1
Coordinates 701885..702286 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag MT49_RS03155 Protein ID WP_003403184.1
Coordinates 701643..701888 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS03120 696923..697453 - 531 WP_003917320.1 two component system sensor kinase HK2 -
MT49_RS03125 697437..698132 - 696 WP_003918099.1 two-component system response regulator TcrA -
MT49_RS03130 698255..698566 + 312 WP_003403164.1 hypothetical protein -
MT49_RS03135 698638..699588 + 951 WP_003900184.1 DUF1259 domain-containing protein -
MT49_RS03140 699829..700413 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MT49_RS03145 700415..701128 + 714 Protein_623 IS607 family element transposase accessory protein TnpB -
MT49_RS03150 701128..701598 + 471 WP_003898523.1 hypothetical protein -
MT49_RS03155 701643..701888 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MT49_RS03160 701885..702286 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
MT49_RS22090 702674..702841 - 168 WP_077385191.1 DUF3800 domain-containing protein -
MT49_RS22095 702874..703071 - 198 WP_003403191.1 hypothetical protein -
MT49_RS03175 703151..704308 - 1158 WP_003898524.1 hypothetical protein -
MT49_RS03180 704360..704581 - 222 WP_003898525.1 DUF4926 domain-containing protein -
MT49_RS03185 704723..705328 + 606 WP_003898526.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T285062 WP_003403187.1 NZ_HG813240:701885-702286 [Mycobacterium tuberculosis 49-02]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT285062 WP_003403184.1 NZ_HG813240:701643-701888 [Mycobacterium tuberculosis 49-02]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References