Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
Location | 695553..696199 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ88 |
Locus tag | MT49_RS03105 | Protein ID | WP_003403137.1 |
Coordinates | 695553..695966 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ89 |
Locus tag | MT49_RS03110 | Protein ID | WP_003403139.1 |
Coordinates | 695963..696199 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS03085 | 691636..693186 | + | 1551 | WP_003905349.1 | MCE family protein | - |
MT49_RS03090 | 693238..693630 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
MT49_RS03095 | 693627..693884 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
MT49_RS03100 | 694067..695302 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
MT49_RS03105 | 695553..695966 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MT49_RS03110 | 695963..696199 | - | 237 | WP_003403139.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MT49_RS03115 | 696303..696809 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
MT49_RS03120 | 696923..697453 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
MT49_RS03125 | 697437..698132 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
MT49_RS03130 | 698255..698566 | + | 312 | WP_003403164.1 | hypothetical protein | - |
MT49_RS03135 | 698638..699588 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
MT49_RS03140 | 699829..700413 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
MT49_RS03145 | 700415..701128 | + | 714 | Protein_623 | IS607 family element transposase accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T285061 WP_003403137.1 NZ_HG813240:c695966-695553 [Mycobacterium tuberculosis 49-02]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|