Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 676108..676727 | Replicon | chromosome |
Accession | NZ_HG813240 | ||
Organism | Mycobacterium tuberculosis 49-02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53779 |
Locus tag | MT49_RS03025 | Protein ID | WP_003403047.1 |
Coordinates | 676320..676727 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O53778 |
Locus tag | MT49_RS03020 | Protein ID | WP_003403039.1 |
Coordinates | 676108..676323 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MT49_RS03010 | 674636..675394 | + | 759 | WP_003898511.1 | Mut7-C ubiquitin/RNAse domain-containing protein | - |
MT49_RS03015 | 675523..676014 | - | 492 | WP_003403017.1 | hypothetical protein | - |
MT49_RS03020 | 676108..676323 | + | 216 | WP_003403039.1 | type II toxin-antitoxin system antitoxin VapB26 | Antitoxin |
MT49_RS03025 | 676320..676727 | + | 408 | WP_003403047.1 | type II toxin-antitoxin system toxin ribonuclease C26 | Toxin |
MT49_RS03030 | 676787..677473 | - | 687 | WP_003403052.1 | LpqN/LpqT family lipoprotein | - |
MT49_RS03035 | 677627..680260 | + | 2634 | WP_003403055.1 | GH92 family glycosyl hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14471.43 Da Isoelectric Point: 4.4493
>T285059 WP_003403047.1 NZ_HG813240:676320-676727 [Mycobacterium tuberculosis 49-02]
VIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQ
AARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
VIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQ
AARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5X3T |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5X3T | |
AlphaFold DB | A0A7U4BSA2 |