Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
| Location | 638632..639308 | Replicon | chromosome |
| Accession | NZ_HG813240 | ||
| Organism | Mycobacterium tuberculosis 49-02 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPQ9 |
| Locus tag | MT49_RS02855 | Protein ID | WP_003898500.1 |
| Coordinates | 638632..639045 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TPR0 |
| Locus tag | MT49_RS02860 | Protein ID | WP_003402915.1 |
| Coordinates | 639042..639308 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MT49_RS02825 | 633977..634279 | - | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
| MT49_RS02830 | 634339..634617 | - | 279 | WP_003402901.1 | hypothetical protein | - |
| MT49_RS02835 | 634614..635867 | - | 1254 | WP_003402904.1 | inorganic phosphate transporter family protein | - |
| MT49_RS02840 | 635987..636373 | - | 387 | WP_003402907.1 | VOC family protein | - |
| MT49_RS02845 | 636436..637320 | - | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
| MT49_RS02850 | 637416..638318 | - | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
| MT49_RS02855 | 638632..639045 | - | 414 | WP_003898500.1 | PIN domain-containing protein | Toxin |
| MT49_RS02860 | 639042..639308 | - | 267 | WP_003402915.1 | antitoxin VapB3 | Antitoxin |
| MT49_RS02865 | 639500..641215 | - | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
| MT49_RS02870 | 641293..642897 | + | 1605 | WP_003402920.1 | amidohydrolase | - |
| MT49_RS02875 | 642894..643874 | + | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T285058 WP_003898500.1 NZ_HG813240:c639045-638632 [Mycobacterium tuberculosis 49-02]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|