Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4184610..4185279 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2V4FX75 |
| Locus tag | SMB2099_RS19790 | Protein ID | WP_033649453.1 |
| Coordinates | 4184610..4185032 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | SMB2099_RS19795 | Protein ID | WP_004931679.1 |
| Coordinates | 4185013..4185279 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS19770 | 4180499..4181017 | + | 519 | WP_033635825.1 | flavodoxin FldB | - |
| SMB2099_RS19775 | 4181055..4182419 | - | 1365 | WP_041036554.1 | cell envelope integrity protein CreD | - |
| SMB2099_RS19780 | 4182500..4183918 | - | 1419 | WP_079656783.1 | two-component system sensor histidine kinase CreC | - |
| SMB2099_RS19785 | 4183915..4184610 | - | 696 | WP_049232287.1 | two-component system response regulator CreB | - |
| SMB2099_RS19790 | 4184610..4185032 | - | 423 | WP_033649453.1 | protein YgfX | Toxin |
| SMB2099_RS19795 | 4185013..4185279 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| SMB2099_RS19800 | 4185600..4186592 | + | 993 | WP_079656784.1 | tRNA-modifying protein YgfZ | - |
| SMB2099_RS19805 | 4186631..4187128 | - | 498 | WP_033649451.1 | DUF2165 domain-containing protein | - |
| SMB2099_RS19810 | 4187279..4187953 | - | 675 | WP_079656785.1 | hemolysin III family protein | - |
| SMB2099_RS19815 | 4188137..4188745 | + | 609 | WP_025304127.1 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16471.59 Da Isoelectric Point: 10.8114
>T285051 WP_033649453.1 NZ_HG738868:c4185032-4184610 [Serratia marcescens SMB2099]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAAQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLLPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEDP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAAQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLLPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEDP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|