Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3810993..3811649 | Replicon | chromosome |
Accession | NZ_HG738868 | ||
Organism | Serratia marcescens SMB2099 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2V4G0W2 |
Locus tag | SMB2099_RS18015 | Protein ID | WP_041036282.1 |
Coordinates | 3810993..3811382 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
Locus tag | SMB2099_RS18020 | Protein ID | WP_004941563.1 |
Coordinates | 3811386..3811649 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SMB2099_RS18000 | 3807460..3808890 | + | 1431 | WP_033648838.1 | MFS transporter | - |
SMB2099_RS18005 | 3808887..3810269 | + | 1383 | WP_033635541.1 | two-component system sensor histidine kinase BaeS | - |
SMB2099_RS18010 | 3810269..3810985 | + | 717 | WP_033635542.1 | two-component system response regulator BaeR | - |
SMB2099_RS18015 | 3810993..3811382 | - | 390 | WP_041036282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
SMB2099_RS18020 | 3811386..3811649 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
SMB2099_RS18025 | 3811989..3812327 | + | 339 | WP_033635544.1 | YegP family protein | - |
SMB2099_RS18030 | 3812508..3813860 | + | 1353 | WP_033635545.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
SMB2099_RS18040 | 3814326..3815231 | + | 906 | WP_060428951.1 | lipid kinase YegS | - |
SMB2099_RS18045 | 3815521..3816570 | + | 1050 | WP_033635553.1 | class I fructose-bisphosphate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14309.56 Da Isoelectric Point: 7.8786
>T285049 WP_041036282.1 NZ_HG738868:c3811382-3810993 [Serratia marcescens SMB2099]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMEKKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMEKKGKIMGALDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|