Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1628660..1629213 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A2V4FZ31 |
| Locus tag | SMB2099_RS07810 | Protein ID | WP_019454426.1 |
| Coordinates | 1628899..1629213 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | SMB2099_RS07805 | Protein ID | WP_039566839.1 |
| Coordinates | 1628660..1628896 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS07790 | 1625127..1626662 | + | 1536 | WP_033646792.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
| SMB2099_RS07795 | 1626715..1627635 | + | 921 | WP_049213005.1 | glutathione ABC transporter permease GsiC | - |
| SMB2099_RS07800 | 1627645..1628553 | + | 909 | WP_049233469.1 | glutathione ABC transporter permease GsiD | - |
| SMB2099_RS07805 | 1628660..1628896 | + | 237 | WP_039566839.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| SMB2099_RS07810 | 1628899..1629213 | + | 315 | WP_019454426.1 | CcdB family protein | Toxin |
| SMB2099_RS07815 | 1629253..1630095 | - | 843 | WP_049213004.1 | S-formylglutathione hydrolase | - |
| SMB2099_RS07820 | 1630110..1631234 | - | 1125 | WP_033637718.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| SMB2099_RS07825 | 1631265..1632185 | - | 921 | WP_049213003.1 | LysR family transcriptional regulator | - |
| SMB2099_RS07830 | 1632291..1633448 | + | 1158 | WP_049213010.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | yagZ/ecpA / yagW/ecpD / galU / galF / wza / manB / galE / gnd | 1515045..1744650 | 229605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11745.68 Da Isoelectric Point: 5.0488
>T285043 WP_019454426.1 NZ_HG738868:1628899-1629213 [Serratia marcescens SMB2099]
MQFTVYANRGNSAVYPLLLDVTSDIIGQLNRRVVIPLLPVEKYPGSTRPERLIPLIRLIDDNEYAVMTYEMASIPVRALG
AEFCDVSQYRTRIKAAIDFLLDGI
MQFTVYANRGNSAVYPLLLDVTSDIIGQLNRRVVIPLLPVEKYPGSTRPERLIPLIRLIDDNEYAVMTYEMASIPVRALG
AEFCDVSQYRTRIKAAIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|