Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1139523..1140144 Replicon chromosome
Accession NZ_HG738868
Organism Serratia marcescens SMB2099

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag SMB2099_RS05385 Protein ID WP_004940313.1
Coordinates 1139523..1139726 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag SMB2099_RS05390 Protein ID WP_004940312.1
Coordinates 1139776..1140144 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SMB2099_RS05360 1135302..1135748 + 447 WP_033647279.1 type II secretion system protein M -
SMB2099_RS05365 1135785..1136600 + 816 WP_060426613.1 A24 family peptidase -
SMB2099_RS05370 1136597..1136959 - 363 WP_033653248.1 type II secretion system pilot lipoprotein GspS -
SMB2099_RS05375 1137213..1138655 + 1443 WP_079656257.1 N-acetylglucosamine-binding protein GbpA -
SMB2099_RS05380 1138708..1139226 + 519 WP_043146740.1 cytochrome b/b6 domain-containing protein -
SMB2099_RS05385 1139523..1139726 - 204 WP_004940313.1 hemolysin expression modulator Hha Toxin
SMB2099_RS05390 1139776..1140144 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
SMB2099_RS05395 1140303..1140656 - 354 WP_033653245.1 hypothetical protein -
SMB2099_RS05400 1141063..1141776 + 714 WP_033647273.1 ABC transporter ATP-binding protein -
SMB2099_RS05405 1141773..1142630 + 858 WP_033637343.1 metal ABC transporter permease -
SMB2099_RS05410 1142656..1143534 + 879 WP_041033680.1 metal ABC transporter substrate-binding protein -
SMB2099_RS05415 1143641..1143781 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
SMB2099_RS05420 1143794..1144048 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T285042 WP_004940313.1 NZ_HG738868:c1139726-1139523 [Serratia marcescens SMB2099]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT285042 WP_004940312.1 NZ_HG738868:c1140144-1139776 [Serratia marcescens SMB2099]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References