Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 105856..106391 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | SMB2099_RS00495 | Protein ID | WP_079656094.1 |
| Coordinates | 106116..106391 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | SMB2099_RS00490 | Protein ID | WP_063989142.1 |
| Coordinates | 105856..106116 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS00470 | 101174..101824 | + | 651 | WP_033636562.1 | DcrB-related protein | - |
| SMB2099_RS00475 | 101865..102470 | + | 606 | WP_060452988.1 | glutathione S-transferase | - |
| SMB2099_RS00480 | 102540..103934 | + | 1395 | WP_079656092.1 | L-seryl-tRNA(Sec) selenium transferase | - |
| SMB2099_RS00485 | 103931..105772 | + | 1842 | WP_079656093.1 | selenocysteine-specific translation elongation factor | - |
| SMB2099_RS00490 | 105856..106116 | + | 261 | WP_063989142.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| SMB2099_RS00495 | 106116..106391 | + | 276 | WP_079656094.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| SMB2099_RS00500 | 106403..107314 | - | 912 | WP_079656095.1 | LysR family transcriptional regulator | - |
| SMB2099_RS00505 | 107436..108062 | + | 627 | WP_079656096.1 | LysE family translocator | - |
| SMB2099_RS00510 | 108116..109363 | - | 1248 | WP_033638635.1 | MFS transporter | - |
| SMB2099_RS00515 | 109581..110573 | + | 993 | WP_033649523.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10550.31 Da Isoelectric Point: 10.6099
>T285040 WP_079656094.1 NZ_HG738868:106116-106391 [Serratia marcescens SMB2099]
MALKWTSKALSDLARLFEFLALANRTAAANSVKTLVAAPKALLDNPRLGERLDEFLPQEVRRILVGRYEIRYQVQPATIY
VLRIWHTREER
MALKWTSKALSDLARLFEFLALANRTAAANSVKTLVAAPKALLDNPRLGERLDEFLPQEVRRILVGRYEIRYQVQPATIY
VLRIWHTREER
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|