Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 63238..63839 | Replicon | chromosome |
| Accession | NZ_HG738868 | ||
| Organism | Serratia marcescens SMB2099 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | SMB2099_RS00305 | Protein ID | WP_060439330.1 |
| Coordinates | 63238..63618 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A086G6A0 |
| Locus tag | SMB2099_RS00310 | Protein ID | WP_004933932.1 |
| Coordinates | 63618..63839 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMB2099_RS00280 | 58491..59771 | + | 1281 | WP_079656084.1 | DUF3748 domain-containing protein | - |
| SMB2099_RS00285 | 59802..60149 | - | 348 | WP_033636538.1 | YceK/YidQ family lipoprotein | - |
| SMB2099_RS00290 | 60460..60873 | + | 414 | WP_047569943.1 | heat shock chaperone IbpA | - |
| SMB2099_RS00295 | 60974..61402 | + | 429 | WP_079656085.1 | heat shock chaperone IbpB | - |
| SMB2099_RS00300 | 61569..63227 | + | 1659 | WP_033649549.1 | putative transporter | - |
| SMB2099_RS00305 | 63238..63618 | - | 381 | WP_060439330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SMB2099_RS00310 | 63618..63839 | - | 222 | WP_004933932.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| SMB2099_RS00315 | 63914..65164 | - | 1251 | WP_004933935.1 | valine--pyruvate transaminase | - |
| SMB2099_RS00320 | 65300..67363 | - | 2064 | WP_079656086.1 | alpha-amylase | - |
| SMB2099_RS24460 | 67560..67712 | + | 153 | WP_019455508.1 | hypothetical protein | - |
| SMB2099_RS00325 | 67714..68691 | - | 978 | WP_033636542.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14167.50 Da Isoelectric Point: 7.3170
>T285039 WP_060439330.1 NZ_HG738868:c63618-63238 [Serratia marcescens SMB2099]
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLIPYRL
MVAQRALFDTNILIDYLNGIPQAKDVLTEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRTLISRNPKDFGTDNGVLIPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|